KEGG   Brucella abortus 9-941: BruAb1_1791Help
Entry
BruAb1_1791       CDS       T00241                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmb  Brucella abortus 9-941
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bmb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmb00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bmb00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bmb00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bmb00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1757154..1759109
Genome map
AA seq 651 aa AA seqDB search
MSEKLYPVLPEAKKNTLIDNETYLEWYEESVSDPDGFWAKHGRRIDWFKPFTKVKNTDFN
GDVTIKWYEDGVTNVSYNCIDRHLKSRGDKVAIIWEGDNPYIDKKITYRELYENVCRMAN
VLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTF
VITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDLWYHQE
VASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHDGEI
YWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTA
LRALMGAGDEFVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGG
ILITPLPGATDLKPGSATRPFFGVKPVLVDNEGNVQEGVADGNLCISDSWPGQMRTVYGD
HKRFIETYFSTYKGMYFSGDGCRRDEDGYYWITGRVDDVLNISGHRLGTAEIESALVSHH
SVSEAAVVGYPHPIKGQGIYCYVTLMTGADAQDPDELRKELVQHVRKEIGPIATPDKIQF
APGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADPGVVDDLIENRQNKK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaagctttaccccgtgctgccggaggcaaagaaaaacacgctcatcgacaac
gagacttatctcgaatggtatgaggagagcgtgagcgacccggatggcttctgggccaag
cacggccggcgtatcgactggttcaagcctttcaccaaggtcaagaacaccgatttcaac
ggcgatgtaacgatcaagtggtatgaggatggcgtcaccaacgtctcatataattgcatc
gaccgccatctgaagagccgcggcgacaaggtcgccatcatctgggaaggcgacaacccc
tatatcgacaagaagatcacctatcgcgagctttacgagaatgtctgccgcatggcgaat
gtgctcaagaagcatggggtgaagaagggcgaccgcgtcacgatctatctgccgatgatc
ccggaagccgcctatgccatgctcgcctgcgcgcgcatcggcgccgtgcattcggtcgtc
tttgccggtttctcgccggaggcgctcgctggccgcatcgttgactgcgaatccactttc
gtcatcaccgccgatgaaggtgtgcgcggcggcaagcctgttgcgctgaaggaaaacacc
gataccgccatcgacatcgccgccaagcaatatgtgatggtcaacaaggtgctggtcgtg
cgccgcaccggcggcaaggtaagctggggccgcggccgcgatctgtggtaccatcaggaa
gtcgcaagcgtcgaaccgcattgcgaaccggaaccgatgaatgcggaagacccgcttttc
attctctacacatccggttccaccggcaagccgaagggtgtgctgcataccaccggcggc
tacctcgtctatgcctcgatgacgcatcaatatgtcttcgattaccatgatggcgagatc
tactggtgcacggcggatgtgggttgggtaacgggccactcctatatcgtctacggaccg
ctggccaatggcgcgacaacgctgatgtttgaaggcgtgcccaacttccccgatcagggc
cgtttctgggaagtcgtcgacaagcaccatgtcaatatcttctacaccgcgccaaccgcg
ctgcgcgcgcttatgggcgcgggcgatgaattcgtaacccgctcatcgcgttcgacgctg
cgcctgctgggctcggtcggcgagccgatcaatccagaggcctgggagtggtattacaat
gtcgtgggcgaccagaaatgccccatcgtcgatacctggtggcagacggaaaatggcggc
atcctcatcaccccacttcccggcgcgaccgatttgaaacccggttcggcaacacgcccg
ttcttcggcgtcaagccggtgctggtggacaatgaaggcaatgtgcaggagggcgtagcc
gacggcaacctgtgcatctccgactcctggccgggccagatgcgcaccgtctatggcgac
cacaagcgtttcatcgaaacctacttctccacctataaggggatgtatttttcgggcgat
ggctgccgccgcgacgaggacggctattactggatcaccggccgcgtcgatgacgtgctg
aatatttccggccatcgcctcggcacggcggaaatcgaatcggcacttgtctcgcatcac
tcggtttcggaagccgccgtggtcggctatccgcacccgatcaagggacagggcatctat
tgctatgtcacgctgatgaccggcgcagacgcgcaggacccggacgagttgcgcaaggaa
ctggtccagcatgtgcgcaaggaaatcggccccatcgccacaccggacaagatccagttt
gcgcccggactgccgaaaacccgttccggcaagatcatgcgccgcatcctgcgcaagatc
gccgaagacgagttcggcgcattgggcgacacctcaacgctcgccgatccgggcgtggtg
gacgacctgatcgaaaatcgccagaacaagaaatga

DBGET integrated database retrieval system