KEGG   Brucella abortus 9-941: BruAb2_0453Help
Entry
BruAb2_0453       CDS       T00241                                 

Definition
6-phosphogluconolactonase
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bmb  Brucella abortus 9-941
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BruAb2_0453
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BruAb2_0453
Enzymes [BR:bmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     BruAb2_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(457134..457832)
Genome map
AA seq 232 aa AA seqDB search
MSIERHDFISATELAQSLSEAIANKLATAIAERGQAVLAVSGGTTPLKLFEVLSRKMIDW
NLVTITLVDERFVPVENERSNEKLVRDHLLRDHAGVARFVGLYNPAATAETAALAAASRI
DALRRPFDVVVLGMGNDGHTASFFPNADRLDQAINPATRALVLPIHAEGAGEKRLTLTLP
LIAEAEMLVLHIEGAAKQATLEKALAGDDEREMPVRAVFHHARAPIQLYWAS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaacggcacgatttcatcagcgcaacggaactggcgcagtcgctttccgag
gcgattgcaaacaagctggcaaccgcgatcgctgaacggggacaggccgtgctggccgtc
tctggcggcaccacgccgctcaagctgtttgaagtgctgtcgcgcaagatgatcgactgg
aaccttgtcacgattaccctcgtggacgagcgttttgtgccggtggagaacgaacgctcc
aacgaaaagctggtgcgcgaccatcttttgcgcgaccatgcgggcgtagccagatttgtc
ggcctctacaatccggcggcgacggccgaaacagcagcacttgccgccgccagccgcatt
gacgcgctgcgccgccctttcgatgtggtggtgcttggcatgggcaatgacggtcatacc
gcttccttcttccccaatgccgaccggctcgatcaggcgatcaacccggcgacacgcgcg
cttgttctgccgatccatgccgaaggcgctggcgaaaagcgcctgacgcttaccctgccg
ctgattgccgaagccgaaatgctggtgctgcatattgaaggcgcggcaaagcaggcgaca
ctggaaaaggcgcttgcaggcgacgatgagcgggaaatgcccgtgcgggctgtcttccat
catgcccgcgcaccgatccagctttactgggcaagttaa

DBGET integrated database retrieval system