KEGG   Brucella abortus bv. 1 9-941: BruAb2_0774Help
Entry
BruAb2_0774       CDS       T00241                                 

Gene name
phbA-2
Definition
(GenBank) PhbA-2, acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmb  Brucella abortus bv. 1 9-941
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BruAb2_0774 (phbA-2)
   00630 Glyoxylate and dicarboxylate metabolism
    BruAb2_0774 (phbA-2)
   00640 Propanoate metabolism
    BruAb2_0774 (phbA-2)
   00650 Butanoate metabolism
    BruAb2_0774 (phbA-2)
  Lipid metabolism
   00071 Fatty acid degradation
    BruAb2_0774 (phbA-2)
   00072 Synthesis and degradation of ketone bodies
    BruAb2_0774 (phbA-2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BruAb2_0774 (phbA-2)
   00310 Lysine degradation
    BruAb2_0774 (phbA-2)
   00380 Tryptophan metabolism
    BruAb2_0774 (phbA-2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BruAb2_0774 (phbA-2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BruAb2_0774 (phbA-2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BruAb2_0774 (phbA-2)
Enzymes [BR:bmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BruAb2_0774 (phbA-2)
Exosome [BR:bmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BruAb2_0774 (phbA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:777866..779065
Genome map
AA seq 399 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVSIDEQPSKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDIDLFEINEAFAVVAMAAMRDLDLPHEKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERIIRCF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggtggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttagcattgac
gagcagccgagcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcgcgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatatcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgaaaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatccgatgcttctga

DBGET integrated database retrieval system