KEGG   Brucella abortus 9-941: BruAb2_0974Help
Entry
BruAb2_0974       CDS       T00241                                 

Gene name
fmt
Definition
methionyl-tRNA formyltransferase (EC:2.1.2.9)
Orthology
K00604  
methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
bmb  Brucella abortus 9-941
Pathway
One carbon pool by folate
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BruAb2_0974 (fmt)
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BruAb2_0974 (fmt)
Enzymes [BR:bmb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     BruAb2_0974 (fmt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(975824..976744)
Genome map
AA seq 306 aa AA seqDB search
MRVVFMGTPEFSVPILTAIIGHGYEVVAAYTQPPRPAGRRGLELTRSPVHEKAEQFGIPV
FTPTSLKGAEEQDVFASLEADVAIVVAYGLLLPKAILDAPRLGCYNGHASLLPRWRGAAP
IQRAIMAGDAETGMMIMKMDEGLDTGPVAMAEKVAITPDMTAGELHDRLSMIGADLMIRA
LGALERESLALQPQAEEGVTYAAKIDKAEARIDWSKPAKDVHNSIRGLSPFPGAWCEMEI
NGAVERVKLQRSTLGEGSGAPGTVLDDRLTIACGEGAVRLATLQRSGGKPLPAQEFLRGQ
RVTKVL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttgttttcatggggacgccggaattttccgtgccgatcctcaccgccatcatc
ggtcacggttatgaggtcgttgcagcctatacgcagccgccgcgcccggcaggccgcaga
ggtctggaactcaccagatcgccggtgcatgaaaaagcagagcaattcggcattccggtt
ttcacgccgacgagcctcaagggcgcggaagagcaggatgttttcgcaagccttgaagcc
gatgtggcgattgtcgtggcctatgggcttttgctgccgaaggccattctcgatgcgccg
cggcttggctgctataacggccatgcgtcgcttttgccgcgttggcgcggtgcagcgccc
atccagcgcgctattatggcaggcgatgcggaaaccggcatgatgatcatgaagatggat
gaggggcttgataccgggcctgtcgccatggccgaaaaggtggccatcacgccggatatg
acggcgggcgaactgcatgatcgcctgagcatgattggcgctgacctgatgatccgcgcg
ctgggcgcgcttgagcgcgaaagccttgccttgcagccgcaggcggaagaaggcgttacc
tatgccgcaaagatcgacaaggcggaggcccgcatcgactggtcgaagcctgcaaaagac
gtgcacaatagcattcgcggcctgtcaccctttccgggcgcgtggtgcgagatggaaatc
aacggtgctgtcgagcgcgtgaagttgcagcgttccacgctgggcgaaggttcgggcgcg
ccgggcacggtgctggatgatcgcctgacgattgcctgcggcgagggcgcggtgcggctt
gccacgctgcaacgttccggcggaaaacccttgcctgcacaagagtttctgcgtgggcag
cgcgtcacgaaggttctctag

DBGET integrated database retrieval system