KEGG   Brucella abortus 9-941: BruAb2_1049Help
Entry
BruAb2_1049       CDS       T00241                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bmb  Brucella abortus 9-941
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bmb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1053748..1054407
Genome map
AA seq 219 aa AA seqDB search
MQMNCDSALLARQSIVDAMRSFEEKGFNHGSSGNISVREGGHIWVTPTGATSTMDPQDMS
LVSLEGEHLAGKTPSSEWRIHTEIMRAHPEAGAVVHSHADACVALSCLRKPLPPFHYMIA
SFGGSEVPCASYRVFGSDALAYEVVRAMGHHRACLMASHGMVVWGRDLAHARLLAEKLET
LARQYILACQIGTPALLSDVELMEVRERYGFYGSQPMPR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgaattgcgattcggcccttttggcccgacagtccatcgtggatgcgatgcgg
tcttttgaggaaaagggattcaatcatggcagcagcggcaacatcagtgttcgggaaggc
gggcatatttgggtgacgccaacgggcgcgacctcgactatggacccgcaggacatgagc
cttgtctcccttgaaggcgagcatctggctggcaaaactccctccagcgaatggcgtatc
cataccgaaatcatgcgggcgcacccggaagccggtgccgtggtccattcccacgcagat
gcctgcgtggcgctttcctgcctgcgcaagccccttccgccattccattacatgatcgct
tccttcggcgggagcgaggtgccttgtgcgtcatatcgcgtattcggatcggacgcgctg
gcttatgaagtcgtgcgtgcgatggggcaccatcgcgcctgtctgatggcaagccacggc
atggtggtgtgggggcgggatctcgcacatgccaggctccttgcagaaaagctcgaaacg
ctggcacggcaatatatattggcctgccagatcggaacacccgccctgttgagcgatgtc
gaactgatggaagtccgggaacgctacggtttttacggcagccaacccatgccgcgctga

DBGET integrated database retrieval system