KEGG   Brucella abortus S19: BAbS19_I00280Help
Entry
BAbS19_I00280     CDS       T00703                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bmc  Brucella abortus S19
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAbS19_I00280 (recR)
DNA repair and recombination proteins [BR:bmc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BAbS19_I00280 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(37647..38345)
Genome map
AA seq 232 aa AA seqDB search
MFGWLIAAMPHPPKFPFPTPLLPYSLTPLQKMSKRIAGPEIERLIQLLARVPGLGPRSAR
RAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSDPCTICTDERRDPATLIVVE
DVSDLWALERAGTMNVRYHVLGGRLSPLDGIGPDDLNIKGLVERVASGAIKEVILAVNAT
VEGQTTAHYITDQLSNFDVRVTRLAHGVPVGGELDYLDEGTLAAALRARTTL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttggctgattgccgccatgccgcatcctcccaaattcccgttccctaccccc
ttactcccctattcccttactcccttacaaaaaatgtccaaacgaatagccggtcctgaa
atcgaacgtctgatccagcttctggcccgcgtgccggggctcggaccgcgctcggcccgc
cgtgcggcgctgcatctcatcaaaaagaaggaagcgcttctggtgccgcttggcggcgcc
atgcaggaggccgctgaaaaggtgcgcatctgttcgtgttgcggcaatgtcgatacgtcc
gacccgtgcacgatctgcaccgatgagcgccgcgatccggcaactttgattgtcgtggag
gatgtatccgatctctgggcgctggagcgggcaggcacaatgaatgtgcgctatcatgta
ttgggtggccgcctgtcaccgctcgatggcatcggcccggacgatctcaacatcaagggg
ctggtggagcgggttgcaagcggcgccatcaaggaagtgatcctcgcggtcaacgccact
gtcgaaggccagacgaccgcccattacatcacagaccagctatcgaatttcgatgtgcgc
gtgacacggcttgcccatggcgttcccgttggcggcgaacttgactatctggatgaaggc
acgcttgctgctgcgttacgggcgcgaaccacgctttaa

DBGET integrated database retrieval system