KEGG   Brucella abortus S19: BAbS19_I01840Help
Entry
BAbS19_I01840     CDS       T00703                                 

Definition
CYSQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bmc  Brucella abortus S19
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BAbS19_I01840
Enzymes [BR:bmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BAbS19_I01840
Transfer RNA biogenesis [BR:bmc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BAbS19_I01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:206464..207309
Genome map
AA seq 281 aa AA seqDB search
MKISASPKAGLDGTALRAVLRDAALEAGRSIMKHYVNGCAVQSKKDASPVTEADHAAEAI
ILAALSSACPDVPVVAEEEVAAGRLPDHLGRKFLLVDPLDGTREFLLRNGDFTVNIGLVE
EGAPVLGIVYAPARNLLFIGSDAGAWAMETTPDHGAGQDQRIFARVSPAEKVAVCSRSHL
TPETERFLAENRIASSVSVGSSLKFCILAKGEADIYPRFGPTMEWDTAAGDAVLRAAGGM
TATLDGRPMIYGQRLRAGAAGFANPDFVAYGAGEAPVFTTA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttccgcctctccaaaagcaggccttgatggcacagccttgcgagccgtcctt
cgcgacgctgcgcttgaggctggccgcagcatcatgaagcattatgtcaatggatgcgcg
gtgcagagcaagaaggatgcctcgcccgtaaccgaggcggatcacgcagcggaagccatt
attcttgcggccctgtcgtcggcctgccccgatgtgccggtggtggcggaggaagaagtt
gcagcagggcgcttgccggatcatctggggcgcaaattccttctggtcgatccgctggac
ggaacccgggaattcctgctgcgcaacggcgattttacggtcaatatcggccttgtcgaa
gagggcgcgccagtactgggtatcgtctatgcaccggcccgcaatctgctgtttatcggt
agcgatgcgggtgcatgggcaatggaaaccacaccggaccatggcgcaggccaggaccag
cggatttttgcgcgggtttcgcccgccgaaaaagtggctgtctgtagccgctcgcacctg
acgcctgaaaccgaacgatttctcgctgaaaaccgcatcgcaagcagcgtttcggttggt
tcctcgcttaaattctgcattcttgccaagggtgaggcggatatttatccgcgtttcggc
ccgacgatggaatgggacacggcggcgggcgatgcggtgctgcgcgcggcgggcggcatg
accgccactctcgacggcaggccgatgatctatggccagcgcctccgtgcaggggcggcg
ggtttcgccaatcccgatttcgtggcctatggggcgggtgaggcgcctgttttcaccacg
gcctga

DBGET integrated database retrieval system