KEGG   Brucella abortus S19: BAbS19_I03890Help
Entry
BAbS19_I03890     CDS       T00703                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bmc  Brucella abortus S19
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bmc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(418954..419853)
Genome map
AA seq 299 aa AA seqDB search
MTAFQNAGPSITRLAPAKINLALHVTGRRDDGYHLLDMLVVFADHGDRIHIEKAGSDSFT
VSGPFASGIPAGRGNLVLKARDALRQHGGPDLSPVAIHLEKNLPIASGIGGGSSDAAATL
LALNTLWQLDLDFEMLAAIGLSLGADLPMCLHGAAHGTPLIARGIGEELNDVSGIAALPM
LLVNDGTALATPDVFRALTRRENAPLPPPACEGTDALCAYLRETRNDLLPAAISLAPQIE
PKLALLRAKGALYAQMSGSGATCFAIFSDESALTRAAKEIADENPGWFAVPSHSFPSRA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattccagaacgccggaccatcgataacgcgccttgcgcctgcaaagatcaat
ctggcgctgcatgtgaccgggcgacgtgacgacggctatcatcttctcgacatgctggtg
gtctttgccgatcacggcgatcgcatccacatcgaaaaagccggcagcgacagttttacg
gtcagcggcccttttgcaagcggcatccccgccgggcggggcaatctggtgctgaaagcg
cgcgatgcgctgcgccagcatggcgggccagacctttcacctgttgccattcatctggaa
aagaacctgcctattgcttccggcattggcggcggatcgagcgatgcggcagcaaccctg
cttgcgctcaacacgctctggcaactcgatctcgattttgaaatgctggccgctatcggc
ctttccctcggtgcagaccttcccatgtgcctgcatggcgcagcccatggcacaccgctg
atcgcgcgcggcattggtgaagagctgaacgatgtttccggaattgcggcccttcccatg
ctgctcgtcaatgacggtaccgcgcttgccacgcccgacgtgttccgcgcgctcacccgc
cgcgagaacgcccccctgccgcctccggcctgtgaagggacagacgccctttgcgcctat
ctgcgtgaaacacgcaatgatcttctgcccgcagccatcagccttgcaccgcagatcgaa
cccaaactcgccctgcttcgcgccaagggtgcactttatgcgcaaatgtccggctccggc
gcaacatgctttgccatttttagcgatgaatcagccctgacacgcgcggcaaaagagatt
gcggatgaaaatccgggctggtttgcagttccttcgcacagctttccttccagagcctga

DBGET integrated database retrieval system