KEGG   Brucella abortus S19: BAbS19_I04730Help
Entry
BAbS19_I04730     CDS       T00703                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bmc  Brucella abortus S19
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bmc00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bmc00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(502922..504313)
Genome map
AA seq 463 aa AA seqDB search
MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVALAVLT
PFTGGEIPAADFERMVREAYGTFRHDAVCPLVQTDANEFVLELFHGPTLAFKDVAMQLLA
RMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDIFILFPNGRVSPVQQRQMTSS
GFSNVHALSIEGNFDDCQNLVKGMFNDLEFCDALSLSGVNSINWARIMPQVVYYFTAALS
LGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATNDNDILSRTLESGAYEMRGV
AQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQSGGFTISEKPLSAIRSEFSA
GRSTVDETAATIESVLSKDGYLLDPHSAIGVKVAREKASGTAPMVVLATAHPAKFPDAVK
AACGVEPQLPAWLCDLMQRKESFTVLHNELKIVEEYVRHHSRA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaagtacgcgtggggaagcaccggttctgggattcagcgatgcattgctc
gcaggcctcgcccgtgatggcggtctttatctgccgcaggaatatccgcaattcacagcc
gaacagatccgcgccctgcgtggaaaatcctatgtcgaagtcgcgctggccgtcctcacg
ccctttaccggcggtgaaattccggcagccgatttcgagcgcatggtccgcgaagcttac
ggaaccttccgtcacgatgccgtctgcccgttggtgcagaccgacgcgaacgaattcgtg
ctggagcttttccatggccccacccttgccttcaaggatgtcgccatgcagcttctggcc
cgcatgatggattatgttctggcacagcgcggcgagcgcgcaacgatcgtcggcgctaca
tccggcgatacgggcggcgcagccatcgaagcctttggcgggcgcgacaacacagacatt
ttcatcctgttccccaatgggcgggtctcgccggtacagcaacgccagatgacgtcttcc
ggcttttccaatgtccatgcgctttccatcgagggcaatttcgacgattgccagaacctc
gtaaaaggcatgttcaatgatctggaattctgtgacgccctgtcgctttccggcgtgaac
tcgatcaactgggcgcgcatcatgccgcaggttgtctattatttcacggcagcactcagc
ctcggcgcaccggaccgcgccgtgtccttcacggtgcccaccggcaatttcggcgatatt
ttcgcaggctacgtcgccaagcgcatgggcctgcccatcgagcaactcatcatcgccacc
aacgacaacgatattctttcgcgcacgctggaaagcggggcctatgagatgcgcggcgta
gcgcagaccacttcgccctcaatggatatccagatttcctccaatttcgagcggcttctg
ttcgaggcacacgggcgcgatgcggcggccgtgcgcgggctgatgcagggcctgaagcaa
tctggcggatttacgatttccgaaaagccgctttcggccatccgcagcgaattttcggct
ggccgctccaccgtcgatgagacggcggcgactatcgaatcggttctttccaaagacggc
tatctgcttgatccgcattcggcgatcggtgtgaaggtcgcgcgtgaaaaagcatccggc
accgccccgatggtggttctggcgaccgcccatccggccaaattcccggatgcggtgaag
gctgcatgtggggtcgagccgcaattgccggcatggctttgcgacctgatgcaacgaaaa
gaaagcttcacagttcttcacaacgagctgaaaatcgtggaagaatatgtgcgccaccat
tcccgagcctga

DBGET integrated database retrieval system