KEGG   Brucella abortus S19: BAbS19_I08380Help
Entry
BAbS19_I08380     CDS       T00703                                 

Definition
glycoside hydrolase, family 3, N-terminal
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bmc  Brucella abortus S19
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAbS19_I08380
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BAbS19_I08380
Enzymes [BR:bmc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BAbS19_I08380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:873097..874116
Genome map
AA seq 339 aa AA seqDB search
MKECKAWIAGISGTKLTPDEIAFFRDETPWGFILFARNVESLEQVSELTAHLRDLTGLDQ
TPVFIDQEGGRVQRLRPPLVPNYPSASEIGAIYARDKEKGLRAAWLHARLHAFDLLKVGV
NADCLPVLDVPVEGAHDVIGMRAYSKNPHAVAEMGRAAAEGLLAGGVLPVVKHMPGHGRA
FSDTHKELARVSVALNELVAHDFVPFKALNDLPMAMSAHVVFDCIDPERPSTLSPTVINT
IIRDVIGFDGLVISDDISMKALSGDLGDITDGIVTAGSDIVLYCSGVMEELVKVAARVPV
LDGKAKRRAELAEVYAGDPDLSDEDEVRAEFNAMFEPIA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtgcaaggcatggattgccggtatatccggcacgaagctcaccccggacgag
attgccttcttccgggatgaaaccccgtggggcttcattctttttgctcgcaatgtggaa
agcctcgaacaggtgagcgagctcaccgcccatctgcgtgacctgacggggctggaccag
acgccggttttcatcgatcaggagggcgggcgcgtgcagcgccttcgcccgccgctggta
ccgaactatccgtccgcgtccgaaattggcgcgatctatgcacgcgacaaggaaaagggg
ttgcgtgccgcctggctccatgcccggctccatgctttcgatctgttgaaggtcggcgtc
aatgcggattgcctgccggttctggatgtgccggtggagggcgcgcatgatgtgatcgga
atgcgggcctattccaaaaacccccatgcggttgcggaaatgggacgcgctgccgccgaa
ggtcttctggctggcggcgttcttcccgtcgtgaagcatatgccgggccatggccgcgcc
ttttccgatacgcataaggaactggcgcgggtcagcgttgcgctcaacgaactggttgcg
catgatttcgtgccgttcaaggcgctcaatgatctgccgatggccatgtccgcccatgtg
gtgttcgattgcatcgacccggaaagaccgtccacgctttcgccgacggttattaatacg
atcattcgcgatgtgatcgggttcgacggccttgtcatcagtgacgacatttccatgaag
gcattgtccggcgatcttggcgatataaccgacggcatcgttacggcgggcagcgatatc
gtgctctattgctcaggcgttatggaggaactggtaaaggttgccgcccgtgtgccggtt
ctggatggcaaagcaaagcgccgggccgaactggcggaagtctatgcgggcgaccccgat
ctttccgacgaggacgaggtgcgcgccgaattcaatgccatgtttgaaccgatagcgtaa

DBGET integrated database retrieval system