KEGG   Brucella abortus S19: BAbS19_I08460Help
Entry
BAbS19_I08460     CDS       T00703                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmc  Brucella abortus S19
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:879908..880576
Genome map
AA seq 222 aa AA seqDB search
MRQATSERPRLSDREGFASFVLRMRGHSIDDPQLFAAIEATPRQSFLAAAWSHLAYSPRT
APLDCGEYMEGIDDQARVISALKLEPGHRVLEIGTGSGFTAAVMSLLSGRVTTVERYRKL
CDHALQQFVSLKRENIMVKHTDGRHGMPGGPFDRIVIWLACDEVPRHFVELLATHSVLIA
PIGPGDGRQIMTRISKVGSRFEQEDLMPVRYQPFIEGTSSVL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaggcaacgtctgaacgcccgcggctttcggaccgggagggatttgcatccttt
gttctgcggatgcgtgggcacagcattgatgatccgcaactttttgcggcaattgaagca
acgccgcgccagagctttctggcggcggcatggtcgcatcttgcctatagcccgcgaacc
gcgccgcttgattgcggtgaatatatggaaggcatagacgatcaggcgcgcgtcatttcc
gccctgaagcttgagcccggccatcgggttctggaaatcggcaccggctccggctttacc
gccgccgttatgtccttgctgtccggccgtgtaacgacggtggaacggtatcgaaaactc
tgcgaccacgctctccagcagttcgtttcgctgaagcgcgagaatatcatggtgaaacat
acagacgggcgccacggtatgccgggcgggccgtttgaccgcattgtcatctggctcgca
tgcgatgaggtgccgcgccatttcgttgaactgctcgccacccatagcgtcctgatagcc
ccgatcggccctggcgatggacgccagatcatgacgcggatttcaaaggttggaagccgt
tttgaacaggaagacctcatgccggttcgatatcagccgttcatcgaaggcacgtcttcc
gttctttag

DBGET integrated database retrieval system