KEGG   Brucella abortus S19: BAbS19_I09750Help
Entry
BAbS19_I09750     CDS       T00703                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmc  Brucella abortus S19
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BAbS19_I09750
Enzymes [BR:bmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BAbS19_I09750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1014215..1014748
Genome map
AA seq 177 aa AA seqDB search
MSTPPKPLRAWLGLGGNIDDPIISMASALRMLDGRSDTRVVSVSPVYRTPPWGKTDQAWF
HNACAQIETALQPLELIAACLDVERSLKRVRLERWGPRIIDIDILVMQDETGRAITMQEP
ALELPHPRMHERAFVLVPLNDIAPSLPVGARTVAEWAADCDRAEMEKARTDAGWWLE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactccgccgaaaccattgcgcgcctggcttggcctcggcggcaatatcgatgat
ccgatcatctccatggcgagcgcgcttcgtatgctggatggacggagcgacacgagggtt
gtttccgtatccccggtctaccggaccccgccatggggcaagacggatcaggcctggttc
cacaatgcctgcgcgcaaatcgaaacggccttgcagccactggaactgattgcggcctgt
ctggacgtggagcgatccttgaaacgtgtgcggctggaacggtggggaccacgcatcatc
gatatcgatattcttgttatgcaggatgagacgggcagggcaatcacgatgcaggaaccg
gcattggagcttccgcatccacgtatgcacgagcgagccttcgttctggtgccgctcaat
gatatcgcaccttcgctgcctgtcggcgcgagaactgttgctgaatgggctgccgattgc
gaccgtgcggaaatggaaaaagcccgcacggatgcgggctggtggttggaatag

DBGET integrated database retrieval system