KEGG   Brucella abortus S19: BAbS19_I10180Help
Entry
BAbS19_I10180     CDS       T00703                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bmc  Brucella abortus S19
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1061134..1061775
Genome map
AA seq 213 aa AA seqDB search
MDARILQDNDDTSLPVNQASVTRIHKKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRV
AKAYQELFGGYSESPEEVLGTTFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYL
PEGRVVGLSKIARVVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRS
IRKQGSSTITTTFTGDFKEKADQQVRFMTLIRT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggacgctcgcatcctccaagataacgacgacaccagcctgcctgtcaatcaggcatcc
gtaaccagaatacacaaaaagccaggcaaggccgaagcggaagctgccgttcgcaccctg
cttttgtgggccggcgaagaccccgatcgtgaaggcttgctggaaacgcccaagcgcgtc
gcaaaagcctatcaggaacttttcggcggctattcggaaagcccggaagaggttcttgga
accactttcgaggaagtcgcaggttacgacgatatggttctggtgaaggatatttccttc
ttctcccattgcgaacaccacatggtgccgatcatcggcaaggcgcacgtcgcctatctg
ccggaaggccgtgtcgtcggcctgtcgaagattgcgcgtgtcgtcgatatttttgcccgc
cgcctgcaaacgcaggaaagcatcacagcgcagattgccgacagcatccagcgcattttg
aagccacgcggcgtcgccgtcatgatcgaggcggaacatatgtgcatggccatgcgcagc
atccgcaagcagggttccagcacgatcaccaccacctttaccggcgatttcaaggaaaag
gcggaccagcaggttcgcttcatgaccctgatccgcacttga

DBGET integrated database retrieval system