KEGG   Brucella abortus S19: BAbS19_I10780Help
Entry
BAbS19_I10780     CDS       T00703                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmc  Brucella abortus S19
Pathway
bmc00010  Glycolysis / Gluconeogenesis
bmc00051  Fructose and mannose metabolism
bmc00562  Inositol phosphate metabolism
bmc01100  Metabolic pathways
bmc01110  Biosynthesis of secondary metabolites
bmc01120  Microbial metabolism in diverse environments
bmc01130  Biosynthesis of antibiotics
bmc01200  Carbon metabolism
bmc01230  Biosynthesis of amino acids
Module
bmc_M00002  Glycolysis, core module involving three-carbon compounds
bmc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAbS19_I10780
   00051 Fructose and mannose metabolism
    BAbS19_I10780
   00562 Inositol phosphate metabolism
    BAbS19_I10780
Enzymes [BR:bmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BAbS19_I10780
Exosome [BR:bmc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BAbS19_I10780
  Exosomal proteins of bladder cancer cells
   BAbS19_I10780
  Exosomal proteins of melanoma cells
   BAbS19_I10780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACD72585
UniProt: A0A0F6AR04
Position
1:complement(1131169..1131933)
Genome map
AA seq 254 aa AA seqDB search
MTPGIRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEG
ETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAA
WAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPVWAIGTGLTP
TVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLK
AADFLAICETYRNL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactccgggaatccgtccgctggttgctggcaactggaaaatgaatggcaagggagaa
tccctgaccgaactgcgcgccatcgctgcgggcctcagctccgacctcggccgcaagctc
gatgcggtcatatgtgtgccggccaccttgctttcgcgtgcggctgaaacgctggaaggc
gaaacggtcggccttggcggacaggatgcccatttcaagacatccggcgcgcatacgggc
gacatttcgccggaaatgctcaaggaagctggtgccacccatgtcattctcggccattcc
gagcgccgcaccgatcatcacgagagcaataagctcatttgcgccaagacggaagccgca
tgggctgcggggctggtggctatcgtctgcgttggagaaaccgccagcgagcgaaaggcg
gagcgtgcgctcgatgtcattggcgaccagctttccggttcgctgccggatggggttacg
gcggaaaacacaatcattgcctatgaacccgtatgggctatcggcaccgggttgacgccg
acggttcaggatgttcgtgcagcgcacgccttcatgcgtgaacagttgatcgaacgtttc
ggcgcaaaaggcgcgcatctgcgccttctttatgggggttcggtgaagccgtccaatgct
gccgaattgctcggtgttgcagatgttgacggcgctcttgtcggcggcgcgagtttgaag
gcggcagacttcctcgccatatgcgaaacctatcgcaatctataa

DBGET integrated database retrieval system