KEGG   Brucella abortus S19: BAbS19_I13870Help
Entry
BAbS19_I13870     CDS       T00703                                 

Definition
Isochorismatase hydrolase family
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bmc  Brucella abortus S19
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BAbS19_I13870
Enzymes [BR:bmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BAbS19_I13870
    3.5.1.-  
     BAbS19_I13870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1437940..1438569
Genome map
AA seq 209 aa AA seqDB search
MIGHALVVIDVQNDFCPGGALAVERGDEIIPIVNRLIGESEKVVVTQDWHPANHSSFASN
HSGSRPFDTVNMSYGPQVLWPDHCVQNSEGAEFHPDLQWWRAQLVVRKGFRIGIDSYSAF
FENDHCTPTGLGGYLRERNIGSLTMVGLATDFCVASSALDAVQQGFQVRVRLDACRGIDL
NGSMNIMLEKMKQAGVELIDEPVSASHLL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccatgcacttgtggttatcgacgtccagaatgatttttgccccggcggcgcc
ttggccgtcgaacgtggcgatgaaatcatcccgatcgtcaaccgcctgatcggggaaagc
gaaaaggtcgtggtcacgcaggattggcatccggccaaccattccagcttcgcctccaac
cactccggcagccgcccgttcgatacggtcaatatgtcttatgggccgcaggtgctctgg
ccggatcattgcgtgcaaaatagcgagggggcagaatttcaccccgatctgcaatggtgg
cgtgcacagcttgtcgtccgcaagggtttccgcattggtatcgacagctactccgcattt
tttgaaaatgaccattgcacgccgacgggccttggcggatatttgcgtgaacgcaatatc
ggatcattgacaatggttggcctcgccaccgatttctgcgtcgccagttcagcgcttgat
gcggtccagcagggctttcaggtgcgggtgcgactcgatgcctgccgcggtattgatctc
aacgggtcgatgaacatcatgctggagaaaatgaaacaggctggcgtcgaactgatcgat
gagcctgtttcagcgtcgcatctactctag

DBGET integrated database retrieval system