KEGG   Brucella abortus S19: BAbS19_I16650Help
Entry
BAbS19_I16650     CDS       T00703                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmc  Brucella abortus S19
Pathway
bmc00071  Fatty acid degradation
bmc00072  Synthesis and degradation of ketone bodies
bmc00280  Valine, leucine and isoleucine degradation
bmc00310  Lysine degradation
bmc00362  Benzoate degradation
bmc00380  Tryptophan metabolism
bmc00620  Pyruvate metabolism
bmc00630  Glyoxylate and dicarboxylate metabolism
bmc00640  Propanoate metabolism
bmc00650  Butanoate metabolism
bmc00900  Terpenoid backbone biosynthesis
bmc01100  Metabolic pathways
bmc01110  Biosynthesis of secondary metabolites
bmc01120  Microbial metabolism in diverse environments
bmc01130  Biosynthesis of antibiotics
bmc01200  Carbon metabolism
bmc01212  Fatty acid metabolism
bmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAbS19_I16650
   00630 Glyoxylate and dicarboxylate metabolism
    BAbS19_I16650
   00640 Propanoate metabolism
    BAbS19_I16650
   00650 Butanoate metabolism
    BAbS19_I16650
  Lipid metabolism
   00071 Fatty acid degradation
    BAbS19_I16650
   00072 Synthesis and degradation of ketone bodies
    BAbS19_I16650
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAbS19_I16650
   00310 Lysine degradation
    BAbS19_I16650
   00380 Tryptophan metabolism
    BAbS19_I16650
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAbS19_I16650
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAbS19_I16650
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAbS19_I16650
Enzymes [BR:bmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAbS19_I16650
Exosome [BR:bmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAbS19_I16650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACD73148
UniProt: A0A0F6ASD2
Position
1:complement(1717637..1718821)
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGFPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGGVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggtttcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaaggggggtgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttgatccgtcgatcatgggaaccgggccgattcccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system