KEGG   Brucella abortus S19: BAbS19_I17840Help
Entry
BAbS19_I17840     CDS       T00703                                 

Definition
succinate dehydrogenase
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bmc  Brucella abortus S19
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAbS19_I17840
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAbS19_I17840
   00650 Butanoate metabolism
    BAbS19_I17840
  Energy metabolism
   00190 Oxidative phosphorylation
    BAbS19_I17840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1853913..1854308)
Genome map
AA seq 131 aa AA seqDB search
MNGMNNDMRIPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEV
RAALSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLAC
VFAILKLSFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatgaataacgatatgcgtattccgctcgggaaggttcgcggtctgggttcg
gcaaaagaaggcaccagccatttctggtatcagcgcctgagcgccgttgccctggtgccg
ctggttctgtttttcatcggcctggtcatttcgctcaatggcgcaagctatgcggaagtc
cgggctgccctgtcacatcccttcaccgctgtggtgatggcgctgtttgtcctcacgggc
gtttatcacatgcgcctgggtatgcaggttattattgaagattatgtgcatggcgaaggc
atgaagatcgtgctggtgatgctgaacaccttctttacggtggtggttggtcttgcctgc
gttttcgcgatcctcaagctcagctttggaggttga

DBGET integrated database retrieval system