KEGG   Brucella abortus S19: BAbS19_I18360Help
Entry
BAbS19_I18360     CDS       T00703                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmc  Brucella abortus S19
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAbS19_I18360
Enzymes [BR:bmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BAbS19_I18360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1901681..1902694
Genome map
AA seq 337 aa AA seqDB search
MTDKLTSAPKHGHTSMLYSKVHTDLDTLDAHITFLGIPYGSAYTIDEVTNDQTRAPTAVR
QATDRAVRNLDRYDFDVDGPLYNGRAIKAVDCGDVVGDPKDPGAHYRNAEAAVRKILAAG
ALPLIIGGDHGIPIPVLRAYDDQGPITLIQIDAHLDWRDHINGVHDGLSSPIRRASEMAH
VKDIFQIGIRAQGTARPEEYEAARAYGSNIITAYELHDVGMDAILDRIPDGGRYYITIDA
DGIDPSVMPAVAGPAFGGVTYAQTRKLLHGLVKKGRVVGMDIVEITPSKDVNQLTAIAAG
RFFVNLIGAAVRADYFGTKAELETAAGKTMKPAHAAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcttacctccgcgccaaagcatggacatacgagcatgctttattccaag
gttcacacggatctcgacacgctcgacgcccacatcacctttcttggtattccttacggc
tctgcctatacgatcgatgaagtcaccaacgaccagacgcgggcgccgacagcagtgcgc
caggcgaccgaccgtgccgtccgcaacctcgaccggtatgacttcgacgtcgatggccct
ctctacaatggccgtgccatcaaggcggtcgattgcggcgatgtggtgggcgaccccaag
gaccctggcgcacattaccgcaatgcggaagcagccgttcgcaagattctcgccgccggc
gccctgcccctcatcatcgggggcgatcacggcatcccgatcccggtcctgcgcgcctat
gacgatcaggggccgatcaccctgatccagatcgacgcccatctggactggcgtgatcac
atcaatggtgtgcatgacggcctttcaagcccgatccgccgcgcttcggaaatggcgcat
gtcaaggatatcttccagatcggcatccgcgcccagggcacggcacgccccgaagaatac
gaggccgcgagagcttacggctccaatatcatcacagcttacgaattgcatgatgtcggc
atggacgccattctcgatcgtattcccgatggcgggcgctattacatcaccatcgatgcc
gacgggatcgatccttccgtcatgcctgcggtggctggtcccgcctttggcggtgtgacc
tatgcccagacgcgcaaactcctgcatggccttgtcaagaaggggcgcgtcgtcggcatg
gatatcgtggagattacgccttccaaggatgtaaaccagcttaccgcgatcgccgccgga
cgtttcttcgtcaacctgattggtgctgccgtgcgcgccgactatttcggcacgaaagca
gagcttgaaacggccgctggcaaaaccatgaaaccggcccacgccgcagcctga

DBGET integrated database retrieval system