KEGG   Brucella abortus S19: BAbS19_I19750Help
Entry
BAbS19_I19750     CDS       T00703                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bmc  Brucella abortus S19
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAbS19_I19750
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAbS19_I19750
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAbS19_I19750
Enzymes [BR:bmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAbS19_I19750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(2049916..2051136)
Genome map
AA seq 406 aa AA seqDB search
MNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQQAYETARNDPEFKAELNALS
TFYAGRPSKLYYAEGLSKHLGGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCIVYVGATDVERQKPNVFRMKLLGAEVKPVSAGNGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQEGRLPDVIV
AAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLEGEEHCASMSAGRPGVLHGNRTYLLQ
NADGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDNEALDAFQLCTRTEGIIPA
LESAHAIAQAVKMAPTMGKDKVMIVNLSGRGDKDVHTVGKLLGMDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaagccggttgcacccaattcctacaagacgggccctgacgaagagggcatgttc
ggcatattcggtggccgcttcgtcgccgaaacgctgatgcctctgatcctcgaattgcag
caggcttatgaaacggcgaggaatgaccccgaattcaaggcggagttgaacgccctttcc
accttttatgccggccgtccttccaagctctattatgccgaaggcctgagcaaacatctg
ggtggcgctaaaatctacttcaagcgcgaagacctgaaccataccggcagccacaagatc
aacaattgccttggccagatcctgcttgccaagcgcatgggcaagacgcgcatcatcgca
gaaacgggcgccggtcagcatggcgtggcgtctgccaccgttgccgcacgcttcggcctg
ccctgtatcgtctatgtgggcgcaaccgacgtggagcgccagaagcccaatgttttccgc
atgaagctgctcggcgcggaagtgaagccggtttctgccggcaatggcacgctgaaagac
gcgatgaacgaagccctgcgtgactgggttacgaatgtcgaggatacctattacctgatc
ggcacggctgccggtccgcacccctatcccgaactggtgcgcgatttccaatccgtcatc
ggcaccgaagcgcgccagcagatactcgaacaggaaggccgcctgccagatgtgatcgtg
gcagcggtcggcggcggctccaacgccattggcctgttccatccgttcctcgacgacgcc
tcggtgaagatcgtcggtgtcgaagcaggcggacgcggtcttgagggagaggaacattgc
gcttcgatgagcgcaggccgccccggcgttctgcatggcaaccgcacctatctcctccag
aacgcggatggccaaattctggaaggccattcggtttccgctggtctcgactatccgggc
gtcgggcccgagcattcgtggctgaaggacagcgggcgcgtcgactatgtgccgatcctc
gacaatgaggcgctggatgcattccagctttgcacccgcaccgaaggcatcatcccggcg
ctcgaatccgcccatgccattgcgcaggccgtcaaaatggcgccgacaatgggcaaggac
aaggtgatgatcgtcaatctgtccggccgcggcgacaaggacgtccacacggtcggcaag
cttctcggcatggatatctga

DBGET integrated database retrieval system