KEGG   Brucella abortus S19: BAbS19_I20450Help
Entry
BAbS19_I20450     CDS       T00703                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bmc  Brucella abortus S19
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bmc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2119898..2120779
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRRGLQPFMEGATVVRVEQNRPDLRFAFPENFAERLSGRRIEALGRRAKYL
TVHLDDGLSIISHLGMSGSFRIEAEDAQGLPGGFHHERSKNSLHDHVVFHLMRPDGASAR
IIYNDPRRFGFMLFAEKGALEEHPLLKDLGVEPTGNLLSGEVLAALFKGRRTPLKAALLD
QRLIAGLGNIYVCEALWRPGLSPMRAAGSVAGEMDVMERLAGAIRSVIAQAIAAGGSSLK
DYIQADGALGYFQHSFSVYGREGKPCRNPACGGTVERVVQSGRSTFFCASCQT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactgccagaggtcgaaacggttcgccgtggtctgcaacccttcatggaaggg
gcaaccgttgtgcgggtggagcagaatcggcccgacctgcgctttgcctttcctgaaaat
tttgccgaacgcctttccggcaggcgcatcgaggcgcttggccgccgtgcgaaatatctg
accgtccatctcgatgacgggctttcgatcatcagccatctcggcatgtccggctcgttt
cgcattgaggcggaggatgcgcaaggtttgccgggcgggtttcatcacgagcgctccaag
aacagcctgcatgaccatgtggtctttcacctcatgcgcccggacggtgcgtctgcacgc
attatttataatgatccgcgccgcttcggtttcatgctctttgccgaaaagggcgcgctg
gaggaacatccgctcctgaaagaccttggtgtggagccgaccggcaatctcctgtcgggc
gaggttctggccgcgcttttcaagggacgccgcacgcccctgaaggccgccttgctcgac
cagaggcttatcgcggggcttggcaatatctatgtctgcgaggcgctctggcgcccaggg
ctttcgccgatgcgcgcggcaggctcggttgcaggcgaaatggacgtgatggagcggctt
gccggggccattcgctccgtcattgcgcaggcgattgcagccggaggctccagccttaag
gattacattcaggccgacggtgcgctcggctatttccagcactctttttccgtctatggc
cgcgagggtaagccatgcagaaaccccgcctgcggcggcactgtcgagcgcgtggtgcaa
tctggtcgttcgacttttttctgtgcctcttgccagacatga

DBGET integrated database retrieval system