KEGG   Brucella abortus S19: BAbS19_II00310Help
Entry
BAbS19_II00310    CDS       T00703                                 

Definition
(GenBank) hypothetical acetoin dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmc  Brucella abortus S19
Pathway
bmc00010  Glycolysis / Gluconeogenesis
bmc00020  Citrate cycle (TCA cycle)
bmc00620  Pyruvate metabolism
bmc01100  Metabolic pathways
bmc01110  Biosynthesis of secondary metabolites
bmc01120  Microbial metabolism in diverse environments
bmc01130  Biosynthesis of antibiotics
bmc01200  Carbon metabolism
Module
bmc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAbS19_II00310
   00020 Citrate cycle (TCA cycle)
    BAbS19_II00310
   00620 Pyruvate metabolism
    BAbS19_II00310
Enzymes [BR:bmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAbS19_II00310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACD73560
UniProt: A0A0F6ATC5
Position
2:30060..31325
Genome map
AA seq 421 aa AA seqDB search
MPVEVVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLL
VKDGARANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPA
SGEVRHKASPLARRLAAELGVSLDGRAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAA
PAEASSKAIPVGIGEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCEIDALLALRSQI
NEKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEGGLITP
IIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAIINPPQ
SAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIEDPMSLL
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccggttgaagtcgtattgcctgccctttcggcaggaatggaagatgcagtcatcgcg
cgctggctcaaggccgaaggcgacgcggtgagcaagggcgacctgatcgccgaagtcgaa
accgacaaggcgacgatggagcttgaagccgaagtggatggccgcattggccagcttctg
gtgaaggacggtgcgcgcgccaatgtcaatcaggtgatcgccctgcttttgaaggaaggc
gaagatgcttctgcaatggccggatttgcggtcggctccagtcctgtggccgtggcagaa
gccgaaacccctgttgcagcctcgccggtgccagccgcaccagcagtaagcgcgcccgcc
tccggtgaagtgcgccacaaggcttcgccgctcgcccgccgcctggctgcggaactgggc
gtttcgctggacgggcgtgcgggaagtggcgcaaggggccgtatcgtacggatcgacgtg
gaacgcgcggccgcctcgaagccggttccggttgccgccgctgccgctccagtcgccgca
cctgcggaagcttcgtcgaaagccattccggttggcatcggcgagtatgaagccgttccg
cacacatccatgcgccgcaccattgcccgccgcctgctggaagccaagacaacggtgccg
catttctatctgaacgtggattgcgagatcgatgcgcttctggcactgcgcagccagatc
aacgagaagcgggaaggttcggcccgtatttccgtcaatgattttgtcatcaaggcttcc
gccgccgccctgcgccgggtgcccgatgccaatgtcatatggacagacgaggcgcttttg
aagctgaaggacgtcgatattgccgttgcggtggcgacggaaggcggccttatcacaccg
attattcgcagtgccgaccagatgagccttggcgctatttcggcgcagatgaagtctctg
gccgcgcgtgcccgcgaaaaccgcctgaagccggaagaattccagggcggtggcttttcg
atttccaatctcggcatgtatggtgtcaaatccttttcggccatcatcaatccgccgcaa
agcgccattctggcggttggcgcgggcgaacgccgcccaatcgaacgcaatggtgagctt
gctttcgccaccatgatgagcgtgacgctttcggttgaccatcgcgcggtcgacggcgcc
ctgggtgcgcaactgctcgcggccttcaaggccggtattgaagatccgatgtctctgctt
gtctag

DBGET integrated database retrieval system