KEGG   Brucella abortus S19: BAbS19_II03450Help
Entry
BAbS19_II03450    CDS       T00703                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
bmc  Brucella abortus S19
Brite
Enzymes [BR:bmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     BAbS19_II03450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(361882..362652)
Genome map
AA seq 256 aa AA seqDB search
MTKFWIGTSWKMNKTLAEARLFAEALKAADAGRSPDIQRFVIPPFTAVREVKEILSGTSV
KVGAQNMHWADQGAWTGEISPLMLKDCNLDIVELGHSERREHFGETNETVGLKVEAAVRH
GLIPLICIGETLEDRESGRAAAVLEEEVRGALSKLSEAQKQAEILFAYEPVWAIGENGIP
ASADYADARQAEIIAVAQSVLARRVPCLYGGSVNPGNCEELIACPHIDGLFIGRSAWNVE
GYLDILARCATKVQAN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattctggattggcacaagctggaaaatgaacaagacgctggccgaagcccgc
cttttcgcggaagcgctgaaagccgccgatgcaggccgctcgccagacatccagcgtttt
gtcatcccgcctttcaccgccgtgcgtgaggtgaaggaaatcctctccggcacatccgtg
aaggttggcgcgcagaacatgcactgggccgatcagggtgcatggaccggtgaaatctcc
ccgctgatgctgaaagattgcaatctcgacattgttgaactgggccattcggagcgccgc
gaacatttcggcgagaccaacgagacggtcggcttgaaagtggaagccgccgtgcgccac
ggcctgatcccgctcatctgcatcggtgaaacgctggaagaccgtgaaagcggacgcgca
gccgcggtgcttgaagaagaagtgcgcggcgcgctttccaagctttccgaggcgcagaag
caggccgaaatcctcttcgcctatgagccagtctgggccatcggcgaaaacggcattccc
gcttccgccgactatgccgatgcgcgacaggccgaaatcatcgcggtggcacaaagcgtg
ctcgctcgccgcgtgccgtgcctttatggcggctcggtcaatccgggcaattgcgaagaa
ctgatcgcctgcccgcatatcgatgggcttttcatcggccgttcggcgtggaacgtcgaa
ggctatctcgacattctggccaggtgcgccaccaaggttcaagcgaattaa

DBGET integrated database retrieval system