KEGG   Brucella abortus S19: BAbS19_II05990Help
Entry
BAbS19_II05990    CDS       T00703                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bmc  Brucella abortus S19
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BAbS19_II05990 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAbS19_II05990 (pyrB)
Enzymes [BR:bmc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BAbS19_II05990 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(630556..631524)
Genome map
AA seq 322 aa AA seqDB search
MTNQTVSPLFPHRHLLGIKGLSPLDILCLLDLADQEIAVSRQPEKKKSVLRGRTQINLFF
EASTRTQSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMQPDILVIRHASAG
AAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRAKGQIENLIVAICGDVLHSRVARS
NILLLNALGARVRVVAPSTLLPAGMADMSVEVFNSMEEGLKDADVVMMLRLQRERMAGSF
VPSVREYFHFYGLDREKLKFAKPDALVMHPGPMNRGVEIASDVADGPQSVIQQQVEMGVA
VRMAVMEALLDPRRNPGNGEPA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaacggtctctccgcttttccctcaccgccacctgcttggcatcaagggg
ctatcgcccctggacattctctgccttctcgatcttgccgatcaggaaatcgctgtctcc
cggcagccggagaagaaaaagtccgtgctgcgcggtcgcacgcaaatcaacctgttcttt
gaagcatcgacacggacgcaatcttcgttcgagctggccggaaaacggctgggcgcggat
gtgatgaatatgtccgtcggcaattcatcggtcaagaaaggcgaaacgctcatcgatacg
gcgatgacgctgaacgctatgcagccggatattctcgtcatccgccatgcttccgccggt
gctgccgcccttctcgcgcagaaagtgggttgctcggtggtcaatgcgggcgacggcgcg
catgaacaccccacacaggcgcttctcgatgcgctgacaatccgccgcgccaagggccag
atcgaaaatctgatcgtcgccatctgcggtgacgttctgcattcgcgcgtggcgcgctcc
aacattctcctgctcaacgcgctcggcgcgcgggtgcgggtggttgcgccttcaacactc
ctgcccgccggcatggccgatatgagcgtggaagttttcaactccatggaggaggggctg
aaagacgctgatgtcgtcatgatgctgcgcctccagcgcgagcgcatggcgggttccttc
gtgccttccgtgcgggaatatttccatttctatggcctggaccgggaaaaactcaaattc
gccaaacctgatgcacttgtgatgcatccggggccgatgaaccggggcgtcgagattgcc
tccgacgttgcggacgggccgcaaagcgtcatccagcaacaggtggaaatgggcgttgcc
gtgcgcatggccgtgatggaggctctgctcgatccgcggcgcaacccaggcaacggagaa
ccggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system