KEGG   Brucella abortus S19: BAbS19_II07380Help
Entry
BAbS19_II07380    CDS       T00703                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bmc  Brucella abortus S19
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BAbS19_II07380
Enzymes [BR:bmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BAbS19_II07380
Exosome [BR:bmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAbS19_II07380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:783037..783861
Genome map
AA seq 274 aa AA seqDB search
MTDPALFGVSIPILGVAGDQQAAVIGNACFEPGMMKSTYGTGCFALLNTGTDRVTSSNRL
LTTIAYRLDGVTTYALEGSIFIAGAAVQWLRDEMGFISVASEVSALAEKADPNQRIYLVP
AFTGLGAPYWDAEARGAIFGLTRGTGRAEFARAALESVAYQTFDLLEAMQGDWKGATNHT
VLRVDGGMVASDWTMQRLADILNAPVDRPVFLETTVLGAAWLAASRAGIWPDRKGFSERW
QRDCRFEPAMPEKERESAIAGWRDSVSRCLTRPQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccctgcccttttcggcgtttccattcctattctcggcgtagcgggcgaccag
caggcggcagtgatcggcaatgcctgcttcgagccaggcatgatgaaatccacctacggc
accggatgttttgcacttctcaacaccggcacggatcgcgtcacctcctccaaccggctg
ctcaccaccatcgcctaccggctcgacggtgttacgacctatgcgctggaaggttcgata
ttcatcgcgggcgcggccgtacaatggcttcgtgacgaaatgggcttcatttcggtcgca
tcggaagtaagcgcgctggccgaaaaggccgacccgaaccagcgcatctatctggttcca
gccttcaccgggcttggcgcaccctattgggacgccgaagcgcgcggcgcaatcttcggg
ttgacgcgcgggacgggccgcgcagaatttgcccgcgcagcacttgaaagcgtggcctat
cagaccttcgaccttctggaagccatgcaaggggactggaaaggcgcaaccaatcacacg
gtgctgcgcgtcgatggaggcatggttgcttccgactggaccatgcagcgactggccgac
attctgaacgcacccgtcgatcgcccggtttttctcgaaaccaccgtgctgggcgccgca
tggctggccgcctcccgcgcaggcatctggccggatcgcaagggtttttcggaacgctgg
cagcgtgattgcaggtttgagccggctatgccggaaaaagaacgtgaaagcgcgattgcg
ggctggcgggatagcgtttcacgctgcctaacacgaccgcaatag

DBGET integrated database retrieval system