KEGG   Brucella abortus S19: BAbS19_II07600Help
Entry
BAbS19_II07600    CDS       T00703                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bmc  Brucella abortus S19
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BAbS19_II07600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAbS19_II07600
  Lipid metabolism
   00071 Fatty acid degradation
    BAbS19_II07600
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAbS19_II07600
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAbS19_II07600
   00626 Naphthalene degradation
    BAbS19_II07600
Enzymes [BR:bmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAbS19_II07600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(804514..805641)
Genome map
AA seq 375 aa AA seqDB search
MKFKAAVLDRHGVERPYNQTKPLVIREVELREPKADEVLVKLAASGLCHSDLSVINGDRS
RQIPMVLGHEAAGVVEKIGEGVTDLVPGDHVVCVFVPNCGHCQPCAEGRPALCEPGAAAN
GKGEMLSGGLRLFCDDGYVYHHCGVSAYAEYAVMSRYSIIRIEKDIPLHIAALMGCAVLT
GTGSIFNTGLVKPGSRVAIAGLGGVGLAAVMGAVAAGATEIIALDMFDDKLALAEQLGAT
KTFNVQSEGVVEAVKEYTKGGVDAAFEYAGSGAALAMCYALTKRGGEVVTAGLPNPKNML
SIPAVSLVAEEKSIRGSYLGSGVPTRDIPLFLDLYRKGKLPVEKLLTHRIKLEEINEGFE
RLAAGKAIRQVVEFN
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaagccgctgttcttgaccgccatggtgtcgaacgcccctacaaccagacc
aaaccgcttgtcattcgtgaagtcgagcttcgcgaacccaaagccgatgaagttctcgtc
aaactcgccgcttcgggcctgtgccattccgacctttcggttatcaatggcgatcgttcg
cgccagatccccatggttctggggcatgaagctgccggtgtagtggaaaagattggtgag
ggtgtcaccgatctggttcccggcgaccatgttgtttgcgttttcgtgcccaattgcggc
cattgccaaccctgcgccgaggggcggcccgccctgtgcgagccgggcgctgcggcaaac
ggcaagggcgaaatgctttccggcgggcttcgtctcttttgtgatgatggctatgtctat
catcattgcggcgtttcagcttatgcggaatatgcggtgatgtcgcgttattcgataatc
cgtatcgaaaaggatattccgcttcatattgcagccctgatgggctgtgcggtgctgacc
gggaccggctcgattttcaataccggtctggtgaagcctggcagcagggttgccatcgcc
ggtcttggcggcgtcggccttgcggcggtgatgggcgccgtggccgcaggcgcgacagag
attatcgccctcgacatgttcgatgacaagctggcgcttgccgaacagcttggggccacc
aaaaccttcaatgtccagtctgaaggcgttgtcgaggcggtcaaggaatatacgaagggc
ggcgtcgatgcggcttttgaatatgccggttcgggtgcggcacttgccatgtgctatgcc
ctgacgaagcgcggcggcgaagtggtcacggctggccttccgaacccgaagaacatgctt
tccattcctgctgtcagccttgtggcggaagaaaaatccattcgcggcagctatcttggt
tccggtgtgccgacgcgggatattcctctgtttcttgatctttatcgcaaaggcaaattg
cctgtcgaaaagcttctcacccatcgtatcaagcttgaagaaattaacgagggttttgag
cgccttgctgctggaaaagcaatccggcaggtcgttgaattcaattga

DBGET integrated database retrieval system