KEGG   Brucella abortus S19: BAbS19_II07740Help
Entry
BAbS19_II07740    CDS       T00703                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
bmc  Brucella abortus S19
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAbS19_II07740
Enzymes [BR:bmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     BAbS19_II07740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:821292..823670
Genome map
AA seq 792 aa AA seqDB search
MSTVPAKGPLTPQQLSLINRYWRAANYLSVGQIYLMKNPLLREPLQPEHIKPRLLGHWGT
TPGLNFIYAHLNRIIQQRNANVIYICGPGHGGPGMVANTYLEGTYSEIYPAISEDEAGME
RLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAAFDNPDLVVACVVGDGEAET
GALATSWHSNKFLNPARDGAVLPILHLNGYKIANPTVLARLSDDDLDNLFRGYGYEPFFV
EGSEPADMHQKMAATLDTIFQRIQDIKKNADVHSPERPRWPMIILRSPKGWTGPKTVDGL
VVENYWRAHEVPVANCRENDAHRKILEDWMKSYDPSDLFDEKGALKPELRALAPKGEARI
GANPHANGGLLRKELHMPDFRQYAVNVTEPGAIEAQSTKILGDFLRDVMKLNETEKNFRI
FGPDETASNRLGSVLEATNRVWMAETLDMDDHLAADGRVMEVLSEHLCQGWLEGYLLSGR
HGFFSCYEAFIHIIDSMFNQHAKWLQVARELEWRKPISSLNYLLTSHVWRQDHNGFSHQD
PGFVDLVANKSADIARVYFPPDANTLLWVGDHCLKTWNRVNVIVAGKQPEPQWLTMAEAE
KHCEAGLGIWEWAGTEDGLEPDIVMACAGDVPTMETLAAVDLLRQSLPHLRIRVVNVVDL
MVLQSPHQHPHGISDEEFDRMFTTNRPVIFAYHGYPYLIHRLVYKRTNHSNFHVRGFIEQ
GTTTTPFDMTVLNELDRFHLAMEAVERLPLGESVAKPLIDNFTEKLALHKDYIRQHGEDM
PEIRDWKWTWPR
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtgccagcaaaagggcctctcacaccgcagcagctttcactcatcaaccgt
tactggcgcgcggcgaattatctttccgtcggccagatttatctgatgaaaaatcccctg
ttgcgcgaaccgctccagcctgagcacatcaagccgcggcttctcggccattggggcacg
acacccggcctcaatttcatctatgcgcatctcaaccgcattattcagcagcgcaacgcc
aatgtgatctatatttgcggccccggccatggcgggccgggcatggtggccaacacctat
ctggagggcacctattccgaaatctatcccgcaatcagcgaagatgaagcgggcatggaa
aggctcttccgccagttttccttccccggcggaataccaagccatgccgcgccggaaaca
ccgggctctatccacgaagggggcgaactgggttatgcgctcgtccacgcctatggtgcg
gccttcgacaatcccgatctggtggtggcctgcgtcgtgggcgacggagaagcggaaacc
ggcgcgcttgcaacttcgtggcactccaacaaattcctcaatccggcgcgcgatggtgcg
gttctgccgatcctgcatctcaatggctacaagatcgccaaccccaccgtgctggcccgc
ctttcggatgatgatctggacaatcttttccgtggctacggttatgagcctttctttgtt
gaaggcagcgagcctgccgacatgcaccagaagatggccgcaacactggacacgattttc
cagcgcattcaggacatcaagaaaaatgccgatgtgcactcgcccgagcgcccgcgctgg
ccgatgattattctcagaagcccgaagggctggaccggcccaaaaaccgtggacggtctg
gttgttgaaaactattggcgcgcccatgaggtgccggttgccaattgccgcgaaaacgat
gcccatcgcaaaatcctcgaagactggatgaagagttacgacccgtccgatctgttcgac
gaaaaaggggcgctgaagcctgaattgcgggcgctggcgccaaagggtgaagcgcgcata
ggggccaatccgcatgccaatggcgggctcttgcgtaaagagcttcacatgccggatttc
cgccaatatgcggtcaatgtcaccgaaccgggagcgatagaagcgcaatcaaccaaaata
ttgggcgattttctgcgcgatgtgatgaaactgaacgagacggaaaagaacttccgcatc
ttcggccccgacgaaaccgcctccaacaggctcggcagcgtattagaggcgacgaaccgg
gtctggatggccgaaacgctggacatggatgaccacctcgccgccgacgggcgtgtaatg
gaggttctcagcgaacatctctgccagggctggcttgaaggctatcttctcagtggccgg
cacggcttcttttcctgctacgaagccttcatccacattatcgattccatgttcaaccaa
catgccaaatggttgcaggttgcgcgcgaactggaatggcgcaagcccatctcatcgctc
aattatctgctgacctcccatgtctggcggcaggaccataacggcttctcccatcaggat
cccggcttcgtcgatctcgtcgccaacaaaagcgccgatatcgcgcgtgtctatttcccg
ccggatgccaacacccttttgtgggtgggagatcactgcctgaaaacctggaaccgcgtg
aatgtcatcgtggcgggcaagcagccggaaccgcaatggctgaccatggcggaggctgag
aaacattgcgaagcaggtctcggcatatgggaatgggcgggtacggaagacgggctggag
ccggatatcgtcatggcctgcgcgggcgatgtgccgaccatggaaacgcttgccgcggtt
gatcttctgcgccagtccctgccgcatctgcgcattcgcgtggtgaatgtggttgacctc
atggtgctgcaatcgccgcatcagcacccgcatggcatttccgatgaggaattcgaccgg
atgttcaccaccaacaggcccgtcatcttcgcctatcacggctatccttatctcatccat
cgactggtctataagcgcaccaaccactccaatttccacgttcgtggttttatcgagcag
ggaacgaccacaacgcctttcgacatgaccgtgctgaacgagctggatcgtttccacctc
gcgatggaagccgtcgagcgcctgccgctgggcgaaagcgttgccaaacccctgatcgac
aatttcacggagaaacttgcgctgcataaggactatatccgacagcatggtgaggacatg
ccggaaatccgcgactggaaatggacatggccgcgataa

DBGET integrated database retrieval system