KEGG   Brucella abortus S19: BAbS19_II08570Help
Entry
BAbS19_II08570    CDS       T00703                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bmc  Brucella abortus S19
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bmc00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(910836..912755)
Genome map
AA seq 639 aa AA seqDB search
MTEETRKSQLSRRQLLGTSAFVAAAGASGLGGALLAGSSETALAAGAAKGGMSPEVKPGE
LDEYYVFFSSGQCGEVRIVGLPSMRELMRIPVFNRDSATGWGLTNESRKVLTEGLLPQDR
EFLKDRGDIFLNGDLHHPHPSFTDGTYDGRYLYANDKANTRVCRIRLDVMKCDKIIQLPN
QHTVHGLRVQKYPKTGYVFCNGEDRVPIPNDGSHLNDVKQYHAIFTAVDGETMKVAWQVM
VDGNLDNVDCDYQGKYAFSTCYNSEEGTTLAEMMSSEQDWIVVFNLKRIEEAVANGDFKE
MNGVPVIDGRHGSKYTRYIPVPNSPHGINTAPDGIHVVANGKLSPTVTVFDVRKFDDLFD
DKIKPRDAVVAEPELGLGPLHTAYDDKGNAYTTLFIDSQICKWNIEDAKRAFKGEKVDPI
RQKLDVHYQPGHNHSSMGQTKEVDGKWLISLNKFSKDRYLNVGPLKPENDQLIDISGDKM
VIVHDGPSFAEPHDATIVHRSKINPVSFWSREDPFFADAVAQAKADGLDLMEANEVVRDG
NKVRVYMTSSAPAFGLTEFTVQQDDEVTVYVTNIDEIEDLTHGFAIVNYGVNMEVAPQAT
ASVTFKASKPGVWWYYCSWFCHAMHMEMQGRMLVEPKKA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaaaccaggaaatcgcagctcagtcgaagacaattgctcggaacatcggca
tttgtcgcggcagccggtgcaagcgggctcggcggggctctgcttgccggttccagcgaa
actgcgcttgcggctggcgccgcaaagggcggcatgagccccgaagtcaagccgggggaa
ctggacgaatattacgtcttcttctccagcggccagtgtggtgaagtgcgtattgtcggc
ctgccgtcgatgcgtgagctgatgcgcatcccggtcttcaaccgtgacagcgccaccggt
tggggcctgacgaatgaaagccgcaaagtgttgacggaaggcctgcttccgcaggatcgt
gaattcctcaaggatcgcggcgacatcttcctcaatggcgacctgcaccacccgcatccc
tctttcaccgatggaacctatgacggtcgttatctttatgccaacgacaaggccaatacg
cgcgtctgccgtatccgcctcgacgtgatgaagtgcgacaagatcattcagttgccgaac
cagcatacggttcacggcctgcgtgtgcagaaatatccgaagaccggctatgtcttctgt
aatggcgaagaccgtgtaccgatcccgaatgatggcagccacctgaatgacgtcaagcag
taccatgccatcttcaccgccgttgacggtgaaacgatgaaggtcgcctggcaggtgatg
gtcgatggcaatctcgacaatgtggattgcgactatcagggcaaatatgccttctctacc
tgctataattcggaagaggggacgacccttgccgaaatgatgtcgagcgagcaggactgg
attgtcgtcttcaacctgaagcgtatcgaagaagccgtcgccaatggcgatttcaaggaa
atgaacggtgtgccggtcatcgacggtcgccacggctccaaatatacgcgctatattccg
gtgccgaacagcccgcacggtatcaacaccgcgccggacggcatccatgtggtcgccaat
ggcaagctgtcgccgaccgtgacggtgttcgatgtgcgcaagttcgacgacctgttcgac
gacaagatcaagccgcgcgacgctgttgtggccgagccggaactggggcttggaccattg
cacacggcctatgatgacaagggcaacgcctatacgacgctcttcatcgacagccagatc
tgcaaatggaacattgaagacgccaagcgcgcattcaagggcgaaaaggtcgatccgatc
cgtcagaagctcgacgttcattatcagccgggccacaatcacagctccatgggccaaacc
aaggaagttgatggcaagtggctgatttcgctgaacaagttctccaaggaccgttacctc
aatgtcggtccgctcaagcctgagaacgaccagctcatcgatatttccggcgataagatg
gtgattgttcacgacggtccgagctttgcggaaccgcatgatgcaacgatcgttcaccgc
tccaagatcaaccctgtcagcttctggagccgtgaggatccattttttgccgatgccgtg
gcgcaggcaaaggcggacggtcttgatctgatggaagccaatgaagtggtgcgtgacggc
aacaaggtgcgtgtctatatgacgtcttccgcgcctgccttcggcctcaccgaattcact
gtccagcaggatgatgaagtgacggtttatgtcaccaatatcgatgagatcgaagacctg
acccatggtttcgctatcgtcaattacggtgtgaacatggaagtcgcaccgcaggcgacg
gcttcggtcacgttcaaggcctccaagccgggtgtgtggtggtattactgctcgtggttc
tgccacgccatgcatatggaaatgcagggccgtatgctcgtcgaaccgaaaaaggcctga

DBGET integrated database retrieval system