KEGG   Brucella abortus S19: BAbS19_II08570Help
Entry
BAbS19_II08570    CDS       T00703                                 

Definition
(GenBank) Twin-arginine translocation pathway signal
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
bmc  Brucella abortus S19
Pathway
bmc00910  Nitrogen metabolism
bmc01120  Microbial metabolism in diverse environments
Module
bmc_M00529  Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BAbS19_II08570
Enzymes [BR:bmc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     BAbS19_II08570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_2 Cu-oxidase_3
Motif
Other DBs
NCBI-ProteinID: ACD74348
UniProt: A0A0F6AVG6
Position
2:complement(910836..912755)
Genome map
AA seq 639 aa AA seqDB search
MTEETRKSQLSRRQLLGTSAFVAAAGASGLGGALLAGSSETALAAGAAKGGMSPEVKPGE
LDEYYVFFSSGQCGEVRIVGLPSMRELMRIPVFNRDSATGWGLTNESRKVLTEGLLPQDR
EFLKDRGDIFLNGDLHHPHPSFTDGTYDGRYLYANDKANTRVCRIRLDVMKCDKIIQLPN
QHTVHGLRVQKYPKTGYVFCNGEDRVPIPNDGSHLNDVKQYHAIFTAVDGETMKVAWQVM
VDGNLDNVDCDYQGKYAFSTCYNSEEGTTLAEMMSSEQDWIVVFNLKRIEEAVANGDFKE
MNGVPVIDGRHGSKYTRYIPVPNSPHGINTAPDGIHVVANGKLSPTVTVFDVRKFDDLFD
DKIKPRDAVVAEPELGLGPLHTAYDDKGNAYTTLFIDSQICKWNIEDAKRAFKGEKVDPI
RQKLDVHYQPGHNHSSMGQTKEVDGKWLISLNKFSKDRYLNVGPLKPENDQLIDISGDKM
VIVHDGPSFAEPHDATIVHRSKINPVSFWSREDPFFADAVAQAKADGLDLMEANEVVRDG
NKVRVYMTSSAPAFGLTEFTVQQDDEVTVYVTNIDEIEDLTHGFAIVNYGVNMEVAPQAT
ASVTFKASKPGVWWYYCSWFCHAMHMEMQGRMLVEPKKA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaaaccaggaaatcgcagctcagtcgaagacaattgctcggaacatcggca
tttgtcgcggcagccggtgcaagcgggctcggcggggctctgcttgccggttccagcgaa
actgcgcttgcggctggcgccgcaaagggcggcatgagccccgaagtcaagccgggggaa
ctggacgaatattacgtcttcttctccagcggccagtgtggtgaagtgcgtattgtcggc
ctgccgtcgatgcgtgagctgatgcgcatcccggtcttcaaccgtgacagcgccaccggt
tggggcctgacgaatgaaagccgcaaagtgttgacggaaggcctgcttccgcaggatcgt
gaattcctcaaggatcgcggcgacatcttcctcaatggcgacctgcaccacccgcatccc
tctttcaccgatggaacctatgacggtcgttatctttatgccaacgacaaggccaatacg
cgcgtctgccgtatccgcctcgacgtgatgaagtgcgacaagatcattcagttgccgaac
cagcatacggttcacggcctgcgtgtgcagaaatatccgaagaccggctatgtcttctgt
aatggcgaagaccgtgtaccgatcccgaatgatggcagccacctgaatgacgtcaagcag
taccatgccatcttcaccgccgttgacggtgaaacgatgaaggtcgcctggcaggtgatg
gtcgatggcaatctcgacaatgtggattgcgactatcagggcaaatatgccttctctacc
tgctataattcggaagaggggacgacccttgccgaaatgatgtcgagcgagcaggactgg
attgtcgtcttcaacctgaagcgtatcgaagaagccgtcgccaatggcgatttcaaggaa
atgaacggtgtgccggtcatcgacggtcgccacggctccaaatatacgcgctatattccg
gtgccgaacagcccgcacggtatcaacaccgcgccggacggcatccatgtggtcgccaat
ggcaagctgtcgccgaccgtgacggtgttcgatgtgcgcaagttcgacgacctgttcgac
gacaagatcaagccgcgcgacgctgttgtggccgagccggaactggggcttggaccattg
cacacggcctatgatgacaagggcaacgcctatacgacgctcttcatcgacagccagatc
tgcaaatggaacattgaagacgccaagcgcgcattcaagggcgaaaaggtcgatccgatc
cgtcagaagctcgacgttcattatcagccgggccacaatcacagctccatgggccaaacc
aaggaagttgatggcaagtggctgatttcgctgaacaagttctccaaggaccgttacctc
aatgtcggtccgctcaagcctgagaacgaccagctcatcgatatttccggcgataagatg
gtgattgttcacgacggtccgagctttgcggaaccgcatgatgcaacgatcgttcaccgc
tccaagatcaaccctgtcagcttctggagccgtgaggatccattttttgccgatgccgtg
gcgcaggcaaaggcggacggtcttgatctgatggaagccaatgaagtggtgcgtgacggc
aacaaggtgcgtgtctatatgacgtcttccgcgcctgccttcggcctcaccgaattcact
gtccagcaggatgatgaagtgacggtttatgtcaccaatatcgatgagatcgaagacctg
acccatggtttcgctatcgtcaattacggtgtgaacatggaagtcgcaccgcaggcgacg
gcttcggtcacgttcaaggcctccaagccgggtgtgtggtggtattactgctcgtggttc
tgccacgccatgcatatggaaatgcagggccgtatgctcgtcgaaccgaaaaaggcctga

DBGET integrated database retrieval system