KEGG   Brucella abortus S19: BAbS19_II09360Help
Entry
BAbS19_II09360    CDS       T00703                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bmc  Brucella abortus S19
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAbS19_II09360 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAbS19_II09360 (glk)
   00052 Galactose metabolism
    BAbS19_II09360 (glk)
   00500 Starch and sucrose metabolism
    BAbS19_II09360 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BAbS19_II09360 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAbS19_II09360 (glk)
   00524 Butirosin and neomycin biosynthesis
    BAbS19_II09360 (glk)
Enzymes [BR:bmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BAbS19_II09360 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:987504..988550
Genome map
AA seq 348 aa AA seqDB search
MTGEDMQAIIDAEQSFKFPVLVGDIGGTNARFSILVDSNAEPKEFPVLQTADYATIDEAI
QHAILDQTAIQPRSVILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQ
ALAVVSLEGHHMEQIGGKPEEAVATRVVLGPGTGLGVAGLFRTRHAWVPVPGEGGHIDIG
PRTERDYQIFPHIERIEGRVTGEQILSGRGLRNLYLGICAADKITPTLETPVDITSAGLD
GSNPQAAETLDLFATYLGRLAGDLALIFMAHGGVYLSGGIPVRILSALKAGSFRATFEDK
APHKAIMRDIPVRVITYQLAALTGLSAFARTPSRFEVSTEGRRWRMRR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacaggagaggacatgcaagcgattatcgacgccgaacagagtttcaagtttccggtt
ctcgtcggcgatatcggcggcaccaatgcccgtttttctatcctcgtggattcaaacgcg
gagccgaaggagtttcccgtgctccagacggcggattatgccacaatagacgaagcgatc
cagcacgccattctggatcagacggccatccagccgcgctctgtcattctggccgtggca
ggcccggtggacggcgacgagatcgacctcaccaattgcgactgggtcgtgcgtcctaaa
aagatgatcgctgatctgggctttgaagacgtgaccgtcctcaatgatttcgaggcgcag
gcccttgccgtggtttcgctggaaggccaccatatggaacagatcggcggcaaaccggag
gaggctgttgccacccgcgtcgtgctcggccccggcacgggccttggcgtggcaggtctg
tttcgcacacgtcatgcatgggttccggttcccggtgaaggcggtcatatcgatatcggt
ccacgcaccgaacgcgactaccagattttcccgcatatcgaacgcatcgaagggcgtgtc
accggcgagcaaattcttagcgggcggggcctgcgcaacctctatctgggcatctgcgcc
gccgacaagatcacgcccacccttgagacgccagtagacattacatccgccggactggac
ggcagcaatccacaagccgcagaaacgcttgacctcttcgccacctatctggggcggctt
gcgggcgaccttgcgctcattttcatggcgcatggcggcgtttatctttcgggtggcatc
ccggtgcgcatcctttccgccctcaaggccggttcgttccgcgcaaccttcgaggacaag
gccccgcacaaggccatcatgcgcgacataccggtccgcgttatcacatatcaactggcg
gccttaaccgggctttccgctttcgcccgcaccccctcgcgctttgaagtttcgaccgag
ggccgccgctggcgcatgcgccgctag

DBGET integrated database retrieval system