KEGG   Brucella abortus S19: BAbS19_II09960Help
Entry
BAbS19_II09960    CDS       T00703                                 

Definition
Class II aldolase/adducin, N-terminal
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bmc  Brucella abortus S19
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BAbS19_II09960
Enzymes [BR:bmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BAbS19_II09960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1053005..1053664
Genome map
AA seq 219 aa AA seqDB search
MQMNCDSALLARQSIVDAMRSFEEKGFNHGSSGNISVREGGHIWVTPTGATSTMDPQDMS
LVSLEGEHLAGKTPSSEWRIHTEIMRAHPEAGAVVHSHADACVALSCLRKPLPPFHYMIA
SFGGSEVPCASYRVFGSDALAYEVVRAMGHHRACLMASHGMVVWGRDLAHARLLAEKLET
LARQYILACQIGTPALLSDVELMEVRERYGFYGSQPMPR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgaattgcgattcggcccttttggcccgacagtccatcgtggatgcgatgcgg
tcttttgaggaaaagggattcaatcatggcagcagcggcaacatcagtgttcgggaaggc
gggcatatttgggtgacgccaacgggcgcgacctcgactatggacccgcaggacatgagc
cttgtctcccttgaaggcgagcatctggctggcaaaactccctccagcgaatggcgtatc
cataccgaaatcatgcgggcgcacccggaagccggtgccgtggtccattcccacgcagat
gcctgcgtggcgctttcctgcctgcgcaagccccttccgccattccattacatgatcgct
tccttcggcgggagcgaggtgccttgtgcgtcatatcgcgtattcggatcggacgcgctg
gcttatgaagtcgtgcgtgcgatggggcaccatcgcgcctgtctgatggcaagccacggc
atggtggtgtgggggcgggatctcgcacatgccaggctccttgcagaaaagctcgaaacg
ctggcacggcaatatatattggcctgccagatcggaacacccgccctgttgagcgatgtc
gaactgatggaagtccgggaacgctacggtttttacggcagccaacccatgccgcgctga

DBGET integrated database retrieval system