KEGG   Bacillus megaterium DSM 319: BMD_0111Help
Entry
BMD_0111          CDS       T01219                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bmd00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
104900..106357
Genome map
AA seq 485 aa AA seqDB search
MSSEVRVRYAPSPTGHLHIGNARTALFNYLFARNQNGKFIIRIEDTDQKRNIEGGEESQL
RYLKWLGIEWDESIDVGGEYGPYRQSERTEIYQKYTEELLEKGLAYYCYCTSEELEKERE
EQQANSQMPRYSGKCRNLTAEQRAELEAEGREPSIRFRVPSNTEIKWNDIVKDEVSFESE
GIGDFVIVKKDGTPTYNYAVAIDDYLMKMTHVLRGDDHISNTPKQILVYEALGWTPPVFG
HMTLIVNENRRKLSKRDESIIQFIEQYKELGYLPEALFNFITMLGWSPVGEEEIFSKEQF
IEIFDPARLSKSPALFDTSKLRWMNNQYMKQLDLDEVVALSVPHLVKAGKVEEARDAETE
QWVRDLVALYQEQMSFGAEIVELTEMFFKKEIDYSEEAKAVLAEEQVPEVLKAFAEEISS
LEEFSADEIKAATKAVQKATGQKGKKLFMPIRVATTGETHGPELPKAISLLGKETVLARL
ESIYS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcgaagtaagagttcgttatgccccgagtccaactggacatcttcatataggg
aatgcaagaacagcactatttaattatttatttgcacgaaatcaaaacggtaaatttatt
atccgtattgaagatacagatcaaaagcgtaatatcgaaggcggagaagaaagtcagctg
cgctatttaaaatggttaggtattgaatgggatgagagtatcgacgtaggcggcgagtat
ggtccttaccgccagtctgaacgtacggaaatctatcaaaaatatacggaagaacttctt
gaaaaaggattagcttattactgttactgtacgtcagaagagcttgaaaaagagcgtgaa
gaacagcaggcgaacagtcaaatgccgcgctattcaggtaagtgccgtaacttaacagct
gaacagcgtgctgaactagaagcagaaggccgtgagccaagcattcgcttccgtgttcct
agtaacacagaaattaaatggaatgatattgtcaaagatgaagtatcatttgagtctgaa
ggcattggtgacttcgttattgtgaaaaaagacggtacaccaacatataattacgctgta
gccattgatgattatctaatgaagatgacacatgttctacgcggagatgaccatatctct
aatacaccgaagcaaattcttgtgtatgaagctttaggctggacgcctcctgtatttggt
catatgacattaatcgtaaatgaaaatcgccgtaagttaagtaaacgtgatgagtcaatc
attcagtttattgagcaatataaagaattaggctacttgccggaagcactgtttaatttt
attacaatgcttggctggtcacctgtgggagaagaagaaatcttctctaaagaacagttc
attgaaatttttgacccagctcgtttatcaaaatctccagcactatttgatacaagcaaa
ttacgttggatgaacaaccaatacatgaaacaattggatttagacgaggtagtagcttta
tcagttcctcacttagtgaaagctggaaaagttgaagaagcgcgcgatgctgaaacagaa
caatgggtacgtgacttagtcgctctataccaagaacaaatgagctttggcgctgagatt
gttgaacttactgaaatgttctttaagaaagaaattgattacagtgaagaagcaaaagca
gtgcttgctgaagaacaagtaccggaagtgttaaaagcatttgctgaagagatttcttcc
ttagaagaattcagcgctgatgaaattaaggcagcaacaaaggctgtacaaaaagcaaca
ggtcaaaaaggtaaaaaactatttatgccaattcgtgtagcaacaacaggcgaaacacac
ggtcctgagcttccaaaagctatttctcttttaggaaaagaaacagttttagctcgttta
gaaagcatttatagttaa

DBGET integrated database retrieval system