KEGG   Bacillus megaterium DSM 319: BMD_0185Help
Entry
BMD_0185          CDS       T01219                                 

Gene name
argI
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159650..160567
Genome map
AA seq 305 aa AA seqDB search
MMGGHIMNKLSIIGVPMDLGQTRRGVDMGPSAIRYAGVIERIENIGYSVEDKGNIEIALA
ERVHSDENTNLKNLKAVADASERLAQTVSDVITNKRFPLVLGGDHSIAIGTLAGVSRHYK
NLGVIWYDAHGDLNTADTSPSGNIHGMPLAASIGIGDDALTRIGGYTPKVKPENIVIIGA
RSLDEGEKELIKEKRIKVYTMHEIDRMGMTKVMEETILYLRDKTDGVHLSLDLDGLDPHD
APGVGTPVIGGISYRESHLAMEMLAESQLITSAEFVEVNPILDERNKTATVAVALMGSLL
GEKLV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgatggggggacatattatgaataagctttcaattattggagtaccaatggatttaggt
caaactcgccgaggggtcgatatggggccaagtgcgatacgatatgcaggtgttattgaa
cgcatcgagaatattggatatagtgtagaagataaagggaatattgaaattgccttagct
gaacgagtacatagtgatgaaaatacaaacttaaagaatttaaaagctgtagcagatgct
agcgagaggcttgctcagaccgtaagtgatgttattacaaataaaaggtttcctttagtg
ctagggggagatcacagcatcgctataggaacactagcaggagtaagtcgtcattataaa
aacttgggcgtgatttggtatgatgcacacggagatttgaatacagcagatacgtctcct
tcaggaaatattcacggtatgccattggcggcaagtataggtataggagacgacgcattg
actcgaattggcggttatacacctaaagtcaagcctgaaaatattgtgattatcggagca
cgttctttagatgaaggagaaaaagagttaataaaggaaaaaaggattaaagtgtatacg
atgcatgagatagatcgaatgggtatgacaaaagtaatggaagaaacaattttatatttg
cgtgataaaacagatggcgttcatctatcactcgatttagatggattggatccacatgat
gcacctggagtaggaacgccggtcatcggtggaataagctacagagaaagtcatttagct
atggagatgttagcagaatctcagctaatcacttctgctgagtttgtggaagtgaatcct
attttagatgaacggaataaaacagctacagtagctgttgcattaatgggctcactttta
ggagagaaattagtataa

DBGET integrated database retrieval system