KEGG   Bacillus megaterium DSM 319: BMD_0459Help
Entry
BMD_0459          CDS       T01219                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmd00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bmd00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bmd00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
426319..428544
Genome map
AA seq 741 aa AA seqDB search
MGILFNERTKEFHLQGRDVSYIFSVLRNGQLGHLYYGKKLKHRSSFQHFLRVETRGASAS
VYEGELAFSLETIKQEYPSYGTTDFREPAYQLLQQNGSRITNFEYDNHKIYKGKKPLNGL
PATYVEEESEATSVEVELIDKLLNASLILTYTVYEDQNIITRHARFKHRGEEPVDILRIM
SGNIDLPTSNYEMVQLSGAWIRERHVKTRMLQPGIQSISSARGTSSSQQNPFLILKNPAA
TEHSGEAYGFSLVYSGNFLGQVEVDHYDVSRITMGIHPFDFQWRLERGQTFQSPELVLAY
SNSGLNGLSQEYHELYRKRLARGKWRDLERPVLINNWEATYFDFNEEKIVHIAKEAQKLG
VELFVLDDGWFGKRNDDTTSLGDWFVDENKLPGGMRSLAQKVTDLGMDFGLWFEPEMISK
QSNLYEKHPDWLIHVPNRHQSHGRNQYVLDFSREEVVNYIYERMEAILSEAPISYIKWDM
NRNITEIGSVGLPANRQFEVVHRYILGVYDLYERLTRKFPAILFESCASGGARFDPGMLY
YAPQAWTSDNTDAIERLKIQYGTSFAYPISSMGAHVSAVPNHQVRRVTSLETRGDVAYFG
AFGYELDVTLMTEDEKETVKQQIQYYKKHRSLIQNGIFYRLKSPFEQDGNVTSWMVVSSD
QKQAIIGYYQVLSRPNPSYERIELKGLHPDYEYTVMETDQTAYGDELMYAGIALTHEYPG
VEAYAEKSGDFVSVIYTLQAQ
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtgggaatcttatttaatgaacgtacaaaggaatttcacctgcagggacgcgatgtaagt
tatatcttttcagtgttgagaaacgggcagctcggtcacttgtactatggaaaaaagctt
aagcaccgttcatcttttcagcattttttacgtgtagaaacaagaggagctagcgcttcg
gtatatgaaggagaactagcattttctcttgaaacaatcaaacaagagtatccttcttat
ggaacaacagacttcagagagccagcctatcaacttcttcaacaaaacggaagccgaatc
acaaattttgaatacgataaccataaaatttacaaaggcaagaagccattaaacggctta
cctgctacatatgtagaagaagagagtgaagccacgagtgtagaagttgaactgattgat
aaattgctcaatgcatcacttattttaacgtataccgtttatgaagaccaaaatattatt
acgcgtcacgcacgatttaagcatagaggagaagaaccagtcgatattttgcgtatcatg
agcggcaacattgatttgcctacatcaaattatgagatggttcagctttccggtgcgtgg
attcgagaaagacacgtgaaaacacgaatgcttcagccaggtattcaaagtatttctagt
gcgagaggtacaagcagcagtcagcaaaacccatttttaattttaaagaatccagctgca
actgaacacagtggagaagcgtatggttttagtcttgtatacagcggaaactttcttgga
caagtggaagtagatcattatgatgtatcaagaataacgatgggcattcatccttttgat
tttcagtggcgactagaaaggggacaaacttttcaatcaccagaactagtactggcttat
tcaaatagcgggctaaacggccttagccaagagtatcatgagctttatcgcaagcgtctt
gctagaggaaaatggcgggatttggagcgaccagttttaattaataactgggaagcgacg
tattttgattttaacgaagagaaaattgtacatattgccaaagaagcgcaaaagctaggc
gttgaactttttgtattggatgacggctggttcggtaaacgtaacgatgatacaacttct
cttggagattggtttgtagatgaaaataagcttccgggcggtatgaggtcattggctcaa
aaagtaacggatttaggtatggactttgggttatggtttgaacctgaaatgatttcaaag
caaagcaacttgtatgaaaagcatccagattggttgattcatgtgccaaatcgtcatcag
tctcatggacgaaatcaatacgtgcttgatttttcaagagaagaagtagtgaattatatc
tatgaacgaatggaagctattttaagtgaagcacctatctcttatataaaatgggatatg
aatcgaaatataacggagattggatctgttgggctgcccgcgaaccgtcagtttgaagta
gtacatcgctatattttaggtgtgtatgacttgtatgagcgactaacaaggaagtttccg
gctattttatttgaatcatgtgcaagcgggggcgctagatttgatccgggaatgctttat
tatgctcctcaagcttggacgagtgataacacggacgcgattgaacgtctaaaaattcag
tacggcacgtcttttgcctatccaatcagttcaatgggagcacacgtatcggccgtacca
aatcatcaagtacgcagagtaacaagtctagaaacaagaggagacgttgcgtattttggc
gcatttggttatgagttagatgttacgctgatgacagaagatgaaaaagaaaccgtaaaa
caacaaattcagtattataaaaaacaccgatcccttattcaaaatggcatattctatcgt
ttaaaaagtccgtttgaacaagatggaaatgtgacgagctggatggttgtttcatccgat
caaaaacaggcaatcatcggttattatcaagtattgtctagaccaaatccttcttacgaa
cgcattgagctaaaagggcttcatcctgattatgaatatacagtgatggaaacagatcaa
acagcttatggagatgagctcatgtacgcaggtattgctctaacccatgagtatccgggt
gttgaagcatacgctgaaaaatctggagactttgtatcggttatttacacactgcaagca
caataa

DBGET integrated database retrieval system