KEGG   Bacillus megaterium DSM 319: BMD_0534Help
Entry
BMD_0534          CDS       T01219                                 

Gene name
glpK
Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00561  Glycerolipid metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BMD_0534 (glpK)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BMD_0534 (glpK)
Exosome [BR:bmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMD_0534 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADF37420
UniProt: D5DAB9
Position
504900..506390
Genome map
AA seq 496 aa AA seqDB search
MEKFILSLDQGTTSSRAMLFNKKGEVVHVAQKEFTQYFPKPGWVEHNASEIWGSILAVIA
SCLSESGVHADQIEGIGITNQRETAVVWEKATGKPVYNAIVWQSRQTSGICEELKAKGLN
DTFRDKTGLLIDAYFSGTKVKWILDNVEGAREKAENGELLFGTIDTWLIWKLSGGKAHVT
DYSNASRTLMFNIYDLKWDDELLDILGVPKSMLPEVKPSSEVYAHTVDYHFFGQSIPIAG
AAGDQQAALFGQACYEKGMAKNTYGTGCFMLMNTGEKAVKSDHGLLTTLAWGINGKVEYA
LEGSIFVAGSAIQWLRDGLRMFKNAAETESYATRVESTDGVYIVPAFVGLGTPYWDSDVR
GAMFGLTRGTKKEHFIRATLESLAYQTRDVLSAMEADSGITLKTLRVDGGAVKNNFLMQF
QSDVLDVPVERPQVNETTALGAAYLAGLAVGYWKDCDEIAQQWNMEKSFEPNMEEEKREE
LYSGWKKAVHATMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatttattttatctttagaccaaggaacaacaagctcacgagcaatgttattt
aataaaaaaggtgaagttgtacatgtagctcaaaaagagtttacgcagtacttcccaaaa
ccaggttgggtagagcataatgctagtgaaatttggggttctatcctagcagttatcgca
tcttgtctatctgagtcaggtgttcatgctgatcaaatcgaagggattggaattaccaat
cagcgtgaaacagcagtagtatgggaaaaagcaacaggaaagccagtatacaatgcaatc
gtatggcagtctcgacaaacgtctggtatttgtgaagagttaaaagcaaaaggattaaac
gatacgttccgcgacaaaacgggattattaattgatgcatacttctctggaacaaaagtg
aagtggattttagataacgtagaaggtgcacgagaaaaagcagaaaacggtgaattgtta
ttcggaacaatcgatacatggttaatttggaagctatcaggcggaaaagcgcatgtaacg
gattactcaaacgcatctcgtacgcttatgttcaatatctatgatttaaaatgggatgat
gaactgctagatattttaggagtaccgaaatccatgcttccagaagtaaagccttcttct
gaagtatacgctcatacagtagattatcacttcttcggtcagagtattccaattgcggga
gcagcaggagatcagcaagccgctttatttggacaagcgtgctatgaaaaaggaatggcg
aagaacacgtatggaacaggttgcttcatgctcatgaatacgggtgaaaaagcagttaag
tccgatcacggtttgttaactacattagcatgggggattaacggcaaagtagaatatgcg
cttgaaggcagtatttttgtagcaggatctgctattcagtggcttcgcgacggtttaaga
atgtttaaaaatgcggctgaaactgaaagctatgcaacgcgagtagagtctacagacggc
gtatatattgtgccagctttcgtaggacttggaacaccttattgggatagcgatgtacgg
ggagcgatgtttggattgactcgcggtacaaaaaaagaacactttatccgtgcaacgctt
gaatcactagcttatcaaacaagagatgtattaagcgcaatggaagcggactctggaatt
acattaaaaacattgcgtgtagacggaggagcagttaagaataatttcttaatgcagttc
caaagtgatgtgttagacgttccggttgaacgtcctcaagtgaatgaaacaacggctctt
ggggcagcatatttagcgggtcttgcggtcggctactggaaagattgcgatgaaattgcg
cagcagtggaatatggaaaaatctttcgaaccaaatatggaagaagaaaagcgtgaagaa
ttatatagcggctggaaaaaagccgtacatgcaacaatggcttttaagtaa

DBGET integrated database retrieval system