KEGG   Bacillus megaterium DSM 319: BMD_0557Help
Entry
BMD_0557          CDS       T01219                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMD_0557
   01230 Biosynthesis of amino acids
    BMD_0557
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMD_0557
  Energy metabolism
   00680 Methane metabolism
    BMD_0557
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMD_0557
Enzymes [BR:bmd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMD_0557
Exosome [BR:bmd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMD_0557
  Exosomal proteins of melanoma cells
   BMD_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(524812..525537)
Genome map
AA seq 241 aa AA seqDB search
MIKLVLIRHGQSVWNLENKFTGWTDVDLSKNGLQEAREAGKVLKKNEYTFDIAYTSVLKR
SIRTLWIVLHQMDFMWIPVYKSWRLNERHYGALQGLNKEETAKKFGEEQVHLWRRSMNER
PPALETTDIRYEASNPKYKELAKGQFPVTENLADTEKRVLEYWDETIAPSIKAGKKVIIS
AHGNTIRALMQYLDNISPDGIANLNIPTSVPLVYELDDNLKPLRHYYLGIDGEIPTHIPS
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtgttgattcggcacggacaaagcgtgtggaatcttgaaaataaattt
acaggctggacggatgtagatctttctaaaaatggattgcaagaagcgcgagaagctgga
aaagtactaaagaaaaacgaatatacttttgatattgcctatacttctgttttaaaacga
tccattcgcactctatggattgtcttacatcaaatggacttcatgtggattcccgtgtat
aaatcttggaggctgaatgaacggcactacggggctcttcaaggtttgaacaaagaagaa
accgcaaaaaaatttggagaagagcaagtgcatttgtggagaaggtcgatgaacgaacgc
cctcctgctttagagacaacagatattcgctatgaagcttccaaccctaagtataaggaa
ttagctaagggacaatttcctgtaacagaaaacttagccgatacagaaaagcgggttcta
gaatactgggacgaaactattgctccttctattaaagctggcaaaaaggttattatttcc
gctcacggtaatacgattagggctctgatgcagtacttggataacatttcgcctgatggc
attgcgaacttgaatattcctacaagcgtgccgcttgtttatgagcttgatgataattta
aagccccttagacattattatttaggcatcgatggagagattcctacccatattccttct
tcataa

DBGET integrated database retrieval system