KEGG   Bacillus megaterium DSM 319: BMD_0637Help
Entry
BMD_0637          CDS       T01219                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMD_0637 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMD_0637 (aceA)
Enzymes [BR:bmd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BMD_0637 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592230..593513
Genome map
AA seq 427 aa AA seqDB search
MKDIRIKNLEENWKSDERWKGIERPYSAEKVIGLRGSIDIEHTLARRGAEKFWNLLKTEP
YVHALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLSGNMYPDQSLYPANSVPHVVKRI
NQALQRADQIQHLEGEGDIDYFAPIVADAEAGFGGQLNVFELMKGMIESGASAVHFEDQL
SSEKKCGHLGGKVLLPTQTAVKNLIAARLAADVMGVPTLLIARTDADAADLITSDVDPVD
RQFITGERTAEGFYRTRAGIDQAIARGLAYAPYADLVWCETSEPNLEQAQKFADAIHEKF
PGKMLAYNCSPSFNWKKKLDKKTIEKFQREIAKMGYKFQFVTLAGFHALNHSMFELARGY
KTRGMAAYSELQEREFASEVNGYTATRHQREVGTGYFDEVAQVVSGGTSSTTALKGSTEE
EQFQTHK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatattcgtataaaaaaccttgaagagaactggaaaagcgatgagcgttggaaa
ggaattgaacgtccatattctgcagaaaaagtcattgggctaagagggtccattgatatt
gaacatacgcttgctagaagaggagccgaaaagttctggaacttattaaaaacagagcca
tacgttcatgccttaggagctttaacagggaatcaagcagtacaacaggtaaaagcaggg
ttaaaagcaatttacttaagcggatggcaagtagctgcagatgcaaatctttcaggaaac
atgtatcctgatcaaagtttatacccggcaaacagcgtgccgcatgttgtgaaacgaatc
aatcaagcgctgcagcgtgccgatcaaattcagcatttagaaggagaaggggatatcgat
tactttgctccaattgtagcagatgcagaagcagggttcggaggacagttaaacgtattt
gaactcatgaaaggaatgattgagtcgggagcatctgccgtacactttgaagatcaatta
tcctctgagaaaaagtgtggtcatctcggcggcaaggtattgcttccaactcaaaccgct
gtgaaaaatttgattgctgctcgtctagctgctgatgtaatgggtgttccaacacttctg
attgctcgtaccgatgctgatgccgctgatttaattacaagtgatgttgatcctgtagat
cgccagtttattacaggtgaacgcaccgctgaaggtttttatcgcacgagagccggaatc
gatcaagctattgctcgtggcttagcatatgcgccatatgcggatctagtatggtgtgag
acgtctgaaccaaacttggaacaagcacaaaaatttgcagatgctattcatgaaaaattc
ccaggtaaaatgcttgcttataactgttcaccatctttcaactggaagaaaaagttagat
aagaaaacgattgaaaaattccaaagagaaattgcaaaaatgggctacaagttccaattt
gttacgcttgctggcttccacgctttaaaccacagcatgtttgagctggcacgaggatat
aaaacaagaggaatggcagcttattcagagttacaagaaagagagtttgctagtgaagta
aatggatatacagctacaagacatcagcgtgaagtaggaacgggctattttgatgaagtg
gcacaagtagtttctggtgggacttcttctacaacagctttaaaaggttccacagaagaa
gagcagtttcagacgcataaataa

DBGET integrated database retrieval system