KEGG   Bacillus megaterium DSM 319: BMD_0782Help
Entry
BMD_0782          CDS       T01219                                 

Definition
(GenBank) hypothetical protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGase ParcG
Motif
Other DBs
NCBI-ProteinID: ADF37644
UniProt: D5DAZ3
Position
complement(753775..754449)
Genome map
AA seq 224 aa AA seqDB search
MTLKFIHGNYLKYNKGTGFISCHVDALHAEPPAADLFTDKIVENLVKKTGCAGIVSTISR
TIADLNRNLNETNHEGIHEYRSTIQEIVKSLKIIDSNNFLLTPYLHLSFHGMKDTHYGPH
AIEVGTLYGQSCSKEVKDWFQQELTKKSEDSFPKIHVIFDNKFVGNESIAFHRQGDNSGY
LGYSHNFNTFQIELSRTLRSKHRTTITKIFSEIIDDFQQTFVAT
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacattaaaattcattcatggaaactacttaaaatacaacaaaggaactggttttata
agctgtcacgtggatgcacttcatgcagaaccacccgctgctgatttatttacggataaa
attgtagaaaatttagtcaagaaaacaggatgtgcaggaatcgttagtacgatttccaga
accatagcagatttaaatagaaatctaaatgaaacaaaccatgaggggatacatgaatat
agaagcacaatccaagaaattgttaaatctttaaaaataatagatagtaataatttcctt
ttaacaccctatttgcatttatcttttcatggaatgaaggacacacattacgggcctcat
gcaattgaagtggggactttatatggacaatcttgctcaaaggaagttaaagattggttc
caacaggagctgactaaaaaatctgaagattcattcccgaaaatccatgtaatatttgat
aataaatttgttgggaacgaatcaattgcctttcacagacaaggtgacaatagcggctat
ctaggttacagtcataattttaatacatttcaaattgaattatcccggactctgcgcagc
aaacacagaactactataacgaagatattttccgagattattgatgactttcaacaaaca
ttcgtcgctacttag

DBGET integrated database retrieval system