KEGG   Bacillus megaterium DSM 319: BMD_0787Help
Entry
BMD_0787          CDS       T01219                                 

Definition
(GenBank) 2-aminoethylphosphonate aminotransferase
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 NTP_transf_3 NTP_transferase Cys_Met_Meta_PP IspD
Motif
Other DBs
NCBI-ProteinID: ADF37649
UniProt: D5DAZ8
Position
761369..763210
Genome map
AA seq 613 aa AA seqDB search
MIKTAVILAAGMGSRIRKRAGNRPKGFLMIDEKSIIEHSISKLIKAGVKTIFIGTGYMKE
EYEKLMIRYPQIKCVYNSRYETTGSLFTLYQFKNYIKEDFLLLESDVIYEKNALETLVNH
SRSDVILASKLNGAGDEVYIEADENNNLKNMSKQKEELNSIYAELVGLTKLSYATFQKLC
DEANTLFQFNQTIDYEYGLVKISEKANVYVHKLDNLAWCEVDDEDHWARATAIVYPIIKA
REGVTHTVKRNILLNPGPATTTDTVKYAQIVEDICPREKEFGETMEFISAELTKFVGNPE
KYTTVLFGGSGTAAVESILSSVIDNGTVVIINNGPYGERMCKIAEIYGLNYLEYKGSAEQ
AIDMNNLEIFIKKISTNVSYLALVHCETSTGLLNDIEKIGEFCAVKNIEMIVDAMSSYAA
VPIDMQKMNISYLAASANKNLQGMAGVSFVIANKDRLEKTEQIKPRNLYLHLYDQYRYFQ
MNKQLRFTPPVQTMYALKQAIIEAQWEGIEKRYERYSKSWTTLTDGITQLGLTYLVPETH
HSKIITSILEPSDKKYNFDIMHDFFYKQGFTIYPGKIDKLETFRIANIGDITYRDIERFL
HLLEQYLNGLKGE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacagctgttattctagctgcagggatggggagcaggattcgtaaaagagct
ggaaaccgccctaaaggttttttgatgattgatgaaaaatcgattattgaacattccatt
tcgaagttaataaaagcaggagtcaagacgatttttattggaacaggatatatgaaagaa
gaatatgaaaagctaatgattagatatcctcaaataaaatgtgtttataattctagatac
gaaacaacgggaagcctgtttacgctgtatcaatttaaaaattatattaaagaagatttt
ttactattggaatcagatgtaatttatgaaaagaatgcgttggaaacattagtaaaccat
tcgagatcagatgtcatactagcaagtaaattgaacggtgctggcgatgaagtttatatt
gaagctgatgaaaataataaccttaagaatatgtcaaaacaaaaagaagagttgaatagt
atctatgcagaactagttggtttaaccaaactctcttatgctacatttcagaaactttgt
gatgaagcaaatacgctgttccagtttaatcaaacgatcgattatgaatatggcctcgtt
aaaatttccgaaaaagcaaatgtgtatgttcataaactggataatttggcatggtgtgaa
gtggatgatgaagatcactgggcaagagcaactgctattgtttatccgattattaaagct
cgagaaggtgttacgcatacagttaagagaaatatactcctaaaccccggaccggcaact
acaacagataccgtcaaatatgctcaaatagtggaagacatttgcccgagagaaaaagaa
tttggagagacgatggaatttatctctgctgaactaacaaaatttgtggggaatccagaa
aagtatactacggtattattcggcggatctggaacggcggcagtggaatcgattttaagt
tcagtaattgataacggtacggttgttattatcaataatggtccatacggtgaaagaatg
tgtaaaatcgctgaaatttatggactgaattatttagaatataaaggctccgccgagcag
gctattgatatgaacaacttagaaatttttataaaaaagatttcaacgaacgtttcttat
ctggcgcttgttcactgtgaaacttccacagggcttcttaatgatattgaaaaaattggg
gaattttgtgcagtgaaaaatatcgaaatgattgtggatgcaatgagttcgtatgcagct
gttccaattgacatgcaaaaaatgaatataagctatctggccgcaagtgcaaataagaac
cttcaaggaatggcaggcgtatcgtttgttatagcaaataaagaccggttagaaaaaacg
gagcaaataaagcctcgtaacctttatcttcatttatatgatcagtatcgatatttccaa
atgaataaacaattgcgttttactcctcctgttcagactatgtacgccttaaagcaggca
attatagaagctcagtgggaaggaattgagaaaagatatgaacgctactcaaaatcatgg
actactttaacggatggaattactcagcttgggttaacctatttggttcctgaaacacat
cattctaaaattattacctctatcctcgagccttccgataaaaagtataattttgatatt
atgcatgattttttttataaacaaggattcaccatttatcctggtaaaattgataaatta
gaaacgtttcgaatagcaaatattggtgatatcacatatagagatatagaaaggtttctt
catcttcttgaacaatatcttaacggtctaaaaggagagtga

DBGET integrated database retrieval system