KEGG   Bacillus megaterium DSM 319: BMD_0804Help
Entry
BMD_0804          CDS       T01219                                 

Gene name
glsA
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMD_0804 (glsA)
   00330 Arginine and proline metabolism
    BMD_0804 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BMD_0804 (glsA)
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BMD_0804 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
779805..780794
Genome map
AA seq 329 aa AA seqDB search
MKREIEQEMSYLHVTAKEQLHEWVEQIKEFSSEGKTADYIPALKDMDSSQLGICLIGADG
TVIQSGDYESVFTLQSISKVISFIAACLCCGIPYVLERVDVEPTGDAFNSIIRLEMHKPG
KPFNPMINAGALTVSSLLSGETAKEKLSYLFDVITMLTGKTPLINETVFESEWQTSHRNR
ALAYYLKETNYLQGEVEEVLEVYLKQCSIEVTTEDIALIGLILSLDGYHPVFHKQVIPKE
VAKLTKALMLTCGMYNASGKFAAFVGMPAKSGVSGGIMSLVPPNTKKQSPFPDGCGIGIY
SPAIDEYGNSVKGVTLLKKIAKEWDLSIF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagaaattgaacaggaaatgtcttacttacacgtcactgcaaaagagcagtta
catgagtgggtagagcaaataaaagaattttcttcagaaggaaaaaccgctgattacatt
ccagctctgaaagatatggactcgtctcaattaggtatttgtttgattggtgctgacgga
actgttatccagtctggagattatgaatcggtatttactcttcaaagtatttctaaagtc
attagctttatagcagcttgcttatgctgcggcattccttatgtgctagagagagtggat
gtagagccaactggagatgcatttaattctattataagactggaaatgcataaaccagga
aagccgttcaatcctatgattaacgccggtgctttaacggtttcatctcttttatctggg
gagacggcaaaagaaaaattaagctatttgtttgatgtgataacaatgcttaccgggaaa
acaccacttattaatgaaacggtctttgaatcagaatggcaaacgtctcatcgaaatcgt
gcgcttgcctactatttaaaagaaacgaattacttacaaggagaagtagaagaggttcta
gaggtttacttaaagcagtgctcaattgaagtaacgactgaagatattgcactgattgga
ttaattctgtcattagacggatatcatccagtatttcacaaacaagtaattccaaaagaa
gtagctaaattaacaaaagcgctcatgcttacatgcggtatgtataatgcttcaggaaag
tttgcggcatttgttggtatgccagctaaaagcggtgtatcgggaggaatcatgtcattg
gtgccacctaatacgaaaaagcagtctccatttccagacggatgcggtatcggaatatac
agtccagctattgatgagtacgggaatagcgtaaaaggcgttacgctgctaaaaaaaatc
gcaaaagaatgggatttgagtattttttag

DBGET integrated database retrieval system