KEGG   Bacillus megaterium DSM 319: BMD_0804Help
Entry
BMD_0804          CDS       T01219                                 

Gene name
glsA
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bmd00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmd00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bmd00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
779805..780794
Genome map
AA seq 329 aa AA seqDB search
MKREIEQEMSYLHVTAKEQLHEWVEQIKEFSSEGKTADYIPALKDMDSSQLGICLIGADG
TVIQSGDYESVFTLQSISKVISFIAACLCCGIPYVLERVDVEPTGDAFNSIIRLEMHKPG
KPFNPMINAGALTVSSLLSGETAKEKLSYLFDVITMLTGKTPLINETVFESEWQTSHRNR
ALAYYLKETNYLQGEVEEVLEVYLKQCSIEVTTEDIALIGLILSLDGYHPVFHKQVIPKE
VAKLTKALMLTCGMYNASGKFAAFVGMPAKSGVSGGIMSLVPPNTKKQSPFPDGCGIGIY
SPAIDEYGNSVKGVTLLKKIAKEWDLSIF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagaaattgaacaggaaatgtcttacttacacgtcactgcaaaagagcagtta
catgagtgggtagagcaaataaaagaattttcttcagaaggaaaaaccgctgattacatt
ccagctctgaaagatatggactcgtctcaattaggtatttgtttgattggtgctgacgga
actgttatccagtctggagattatgaatcggtatttactcttcaaagtatttctaaagtc
attagctttatagcagcttgcttatgctgcggcattccttatgtgctagagagagtggat
gtagagccaactggagatgcatttaattctattataagactggaaatgcataaaccagga
aagccgttcaatcctatgattaacgccggtgctttaacggtttcatctcttttatctggg
gagacggcaaaagaaaaattaagctatttgtttgatgtgataacaatgcttaccgggaaa
acaccacttattaatgaaacggtctttgaatcagaatggcaaacgtctcatcgaaatcgt
gcgcttgcctactatttaaaagaaacgaattacttacaaggagaagtagaagaggttcta
gaggtttacttaaagcagtgctcaattgaagtaacgactgaagatattgcactgattgga
ttaattctgtcattagacggatatcatccagtatttcacaaacaagtaattccaaaagaa
gtagctaaattaacaaaagcgctcatgcttacatgcggtatgtataatgcttcaggaaag
tttgcggcatttgttggtatgccagctaaaagcggtgtatcgggaggaatcatgtcattg
gtgccacctaatacgaaaaagcagtctccatttccagacggatgcggtatcggaatatac
agtccagctattgatgagtacgggaatagcgtaaaaggcgttacgctgctaaaaaaaatc
gcaaaagaatgggatttgagtattttttag

DBGET integrated database retrieval system