KEGG   Bacillus megaterium DSM 319: BMD_0817Help
Entry
BMD_0817          CDS       T01219                                 

Definition
(GenBank) O-acetylhomoserine sulfhydrylase
  KO
K01740  O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00270  Cysteine and methionine metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BMD_0817
Enzymes [BR:bmd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase
     BMD_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 GDC-P Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADF37679
UniProt: D5DB28
Position
complement(795951..797258)
Genome map
AA seq 435 aa AA seqDB search
MSTKKPFRPETQAIHSGQQLDPATFSRAVPIYQTSSFGFKDTEHAASLFNLSEQGYIYTR
IVNPTTDVFEQRIAELEGGVGALGVASGQSATTFSILNIASAGDEIVSASSLYGGTYNLF
SSTLPKLGITVKFVNADNPENFRNAITSKTKAIYAESVGNPQGNVLDIEAVADIAHEHGI
PLIIDNTVPSPYLLRPIDFGADIVVHSATKFLGGHGTAIGGVIVDSGKFDWEASGKFPDL
TTPDPSYHGLVYTEAAGEAAYITKARVQLLRDIGAALSPFNSFLLLQGVETLHLRLERHS
ENALKVAKFLEQHELVQWVNYAGLPSHPSYSLAQKYLPKGQGAILTFGVRGGKNAAAKLI
DSVQLFSHLANIGDSKSLIIHPASTTHQQLSKYEQKASGVTPELIRLSVGTEAIDDLLED
LDYALKASQKVNTTV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaagaaaccatttcgtcctgaaacacaagccatccattctggccaacagctt
gacccggctactttttcgcgtgcggtacctatttatcaaacaagctcatttgggtttaaa
gatacggagcatgctgcatctttatttaatttaagtgaacaaggctacatctacactcga
attgtaaaccctactacggacgtttttgaacagcgaattgctgagttagaaggcggagta
ggtgctctaggagtagcttcgggtcagtcagctactaccttttccattttgaatatcgct
tccgcaggagatgaaattgtatcagcaagcagtttatatggaggaacatataacctcttt
tcgtctacgcttcctaaactgggcattaccgtcaaatttgtaaacgctgataatccagaa
aattttagaaatgcaatcacttccaaaacaaaggcaatttatgctgaatccgttggaaac
ccgcagggaaatgtgctagacatcgaggcagttgcagacattgcccatgaacatggaatt
cctcttattattgataatacggttccaagcccttaccttcttcggcccatcgatttcgga
gcagatattgtcgttcattctgctactaagtttcttggaggacacggaacagcaattggg
ggtgttatcgtagacagtggaaaatttgattgggaagcgagcggaaaatttccagactta
acaactccagatccaagttaccatggccttgtatacacagaagctgccggtgaagctgct
tatattacaaaagcgcgcgttcagcttttacgagatattggagctgctttatcacctttt
aattcctttttactccttcaaggggtagaaacactccatctgcgattagagcgtcacagc
gaaaacgcattaaaggtagcaaaatttttagagcagcatgaattagtacaatgggtaaat
tatgcggggcttccttcccacccttcctattctttggcacaaaaatacttgcctaaaggg
caaggagcaattttaacctttggtgtaaggggaggaaaaaacgctgcggctaagttaatt
gattcggttcagttattttctcatttagccaatatcggcgactctaaatcactcattatt
cacccggcaagcaccactcatcaacagctatctaaatacgaacaaaaagcttcgggtgtg
acgccagaactcattcgtttatcggttggaacagaagcaatcgacgaccttcttgaagat
ttagattatgccttaaaagccagccaaaaagtgaatacaactgtttaa

DBGET integrated database retrieval system