KEGG   Bacillus megaterium DSM 319: BMD_0823Help
Entry
BMD_0823          CDS       T01219                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMD_0823 (folP)
Enzymes [BR:bmd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BMD_0823 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
802709..803557
Genome map
AA seq 282 aa AA seqDB search
MSTLTSQSVIKCGKYELNYADRTLIMGILNVNPDSFSDGGKYYDVDKAVAHAEEMVKQGA
DIIDIGGESTRPGYTRISDEEEIKRIVPVISEVAKRVEVPISVDTYKSEVAKHALEAGAH
IINDIWGAKADPKMAQVAADYNVPIILMHNRHEPNYTNLITDMISDLKESISIAKASGVR
DDQIILDPGVGFGKTAAHNVEAIQHLDQLTKMGYPVLLATSRKGFIGQIVNAPPTERMEG
TAATVYAGIAQGVQMVRVHDVLEIKRFVKMADVLVGKHTFQF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaactttaacgtctcaatcggtcattaaatgcggaaagtatgaactgaattatgcg
gaccgtacgcttattatgggaattttaaacgtaaacccggattcattttcagatggcgga
aaatactacgatgtagataaagcggttgctcatgctgaggaaatggtgaagcaaggagca
gacatcattgatatcggaggagaatcaactcgtcctggttatacaagaattagcgatgaa
gaagagattaaacggattgtgcccgttatttctgaagtggctaagcgcgtagaggtgccg
atttctgtagatacatacaagtcggaagtggccaagcatgcgctagaagcaggagcacat
attattaacgatatatggggcgcaaaggctgatcccaaaatggctcaagttgcagctgac
tataatgttcctattattttaatgcataatcgccatgagcccaattatacaaatctgatt
acagatatgataagtgatttgaaagaaagcatatcaattgcaaaagcttcaggagttcga
gatgatcaaattattttagatccaggcgttggctttggaaaaacggctgcgcataatgta
gaagcgattcagcatctagatcagctgacaaagatgggctatcctgtgctgcttgctact
tctcgtaaaggatttattggacaaatagtcaatgctcctcctacggaaagaatggaagga
actgcagctactgtatatgcagggattgcacaaggcgttcaaatggttcgagttcatgac
gtattagaaatcaagcgctttgtaaagatggcagatgtgctggtaggaaaacatacattt
cagttttaa

DBGET integrated database retrieval system