KEGG   Bacillus megaterium DSM 319: BMD_0823Help
Entry
BMD_0823          CDS       T01219                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
802709..803557
Genome map
AA seq 282 aa AA seqDB search
MSTLTSQSVIKCGKYELNYADRTLIMGILNVNPDSFSDGGKYYDVDKAVAHAEEMVKQGA
DIIDIGGESTRPGYTRISDEEEIKRIVPVISEVAKRVEVPISVDTYKSEVAKHALEAGAH
IINDIWGAKADPKMAQVAADYNVPIILMHNRHEPNYTNLITDMISDLKESISIAKASGVR
DDQIILDPGVGFGKTAAHNVEAIQHLDQLTKMGYPVLLATSRKGFIGQIVNAPPTERMEG
TAATVYAGIAQGVQMVRVHDVLEIKRFVKMADVLVGKHTFQF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaactttaacgtctcaatcggtcattaaatgcggaaagtatgaactgaattatgcg
gaccgtacgcttattatgggaattttaaacgtaaacccggattcattttcagatggcgga
aaatactacgatgtagataaagcggttgctcatgctgaggaaatggtgaagcaaggagca
gacatcattgatatcggaggagaatcaactcgtcctggttatacaagaattagcgatgaa
gaagagattaaacggattgtgcccgttatttctgaagtggctaagcgcgtagaggtgccg
atttctgtagatacatacaagtcggaagtggccaagcatgcgctagaagcaggagcacat
attattaacgatatatggggcgcaaaggctgatcccaaaatggctcaagttgcagctgac
tataatgttcctattattttaatgcataatcgccatgagcccaattatacaaatctgatt
acagatatgataagtgatttgaaagaaagcatatcaattgcaaaagcttcaggagttcga
gatgatcaaattattttagatccaggcgttggctttggaaaaacggctgcgcataatgta
gaagcgattcagcatctagatcagctgacaaagatgggctatcctgtgctgcttgctact
tctcgtaaaggatttattggacaaatagtcaatgctcctcctacggaaagaatggaagga
actgcagctactgtatatgcagggattgcacaaggcgttcaaatggttcgagttcatgac
gtattagaaatcaagcgctttgtaaagatggcagatgtgctggtaggaaaacatacattt
cagttttaa

DBGET integrated database retrieval system