KEGG   Bacillus megaterium DSM 319: BMD_0824Help
Entry
BMD_0824          CDS       T01219                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_3_3 ResB PNTB NicO
Motif
Other DBs
NCBI-ProteinID: ADF37686
UniProt: D5DB35
Position
803809..804003
Genome map
AA seq 64 aa AA seqDB search
MKLALLLVIIIGVAALAGTISAAKKVDEDYGKSKKKSIVNLSIIYGVVFIGSIVGVAWYI
AVRP
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcattgcttcttgtcattattatcggcgttgctgcccttgcaggtacgatc
agtgctgcaaagaaagtagatgaagattacggaaaatctaaaaagaaaagtatagtgaat
ttatctattatttacggagtcgtattcataggatcaatcgtaggagtagcgtggtatatt
gcagtgagaccataa

DBGET integrated database retrieval system