KEGG   Bacillus megaterium DSM 319: BMD_0843Help
Entry
BMD_0843          CDS       T01219                                 

Definition
(GenBank) Transcriptional regulator, PBSX family
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 HTH_24 HTH_28 Sigma70_r4 HTH_25 Pou HTH_Crp_2 HTH_7
Motif
Other DBs
NCBI-ProteinID: ADF37705
UniProt: D5DB54
Position
complement(822331..822549)
Genome map
AA seq 72 aa AA seqDB search
MTLINHVKELRAKHGYTQGDLAEKVGATRQTIAAIEKGNYVPSLLLGLTICDVFQLKMED
VFTLQKEEKNVE
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
ttgactcttattaatcacgtaaaagagcttagagctaaacatggatatacgcaaggagat
ttagctgaaaaagttggagccactcgccaaaccattgcagctattgaaaagggaaattac
gttccttccctactgcttggtttaacaatttgtgatgtctttcaattaaaaatggaagat
gtttttacacttcaaaaggaggagaaaaatgttgagtaa

DBGET integrated database retrieval system