KEGG   Bacillus megaterium DSM 319: BMD_0848Help
Entry
BMD_0848          CDS       T01219                                 

Definition
(GenBank) Transcriptional regulator, gntR family
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DUF410
Motif
Other DBs
NCBI-ProteinID: ADF37710
UniProt: D5DB59
Position
826460..827689
Genome map
AA seq 409 aa AA seqDB search
MAYQQLLAEGYVESRPKSGMYVTNTQFDLLQTDKKPAVFLHPHSETKSCTYDFRYGKVDS
RLFPLNEWKKRYNESLQTYRESLFTYQESQGEESLRKEIATYLYQSRGVVCSKYQIIIGA
GTQQSLNLLAQMLKQSIRDIAFENPCYDGASFVFKQHGFSLKPVSLNNKGINIQELYDSL
ARAVYVTPSHQFPYGMIMPVSRRIELLKWANDRNGFIIEDDYDGEFRYKGSPIPSLQSLD
TKGRVIYTGTFSKSFMPSLRISYLVLPEVLLKEYHERFFLYEQAVPTLHQRTLGLMMKNG
EWSKHLRRVRTAYQLKHSTLLAALQKEFNKNITVSGESAGLHILIRMHNDMNEQELINAA
RKQDVSVYGTSRYWLTEVPKQKPHVLLGFGSLGREEIEEGIKRLKKAWL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcagcagcttttagctgaaggatatgtagaaagcaggcccaaaagtggaatg
tacgtaacgaatacacagtttgatttactgcaaacagataaaaagccggctgtattttta
caccctcactcagaaacaaagtcgtgtacctatgattttcggtatggaaaagttgatagc
cgtttgtttcccttgaatgagtggaaaaaacgatacaatgaaagtcttcaaacttataga
gaatctctgtttacttaccaagaaagtcaaggagaagaatcactgcgaaaagaaattgcg
acgtacctttatcaatcaagaggagtggtttgttcaaaatatcaaattattattggagca
ggtacgcagcaatcactcaatttattagcgcagatgttaaagcaaagcatcagagatatt
gcctttgaaaatccttgttatgacggggctagctttgtatttaaacagcatggattttcc
ttaaaacccgtgtcgcttaataacaaaggcataaacatccaagagctttatgatagccta
gcacgagctgtttatgtcacaccatctcatcagtttccatacggaatgatcatgcctgtt
tcaagaagaatagagcttcttaaatgggcgaatgaccgcaacgggtttattattgaagat
gattatgacggagaatttcgttataaaggctctcctatcccttcattgcaaagcttagac
actaaggggcgcgtcatttatacaggtacattttcaaaatcttttatgccttctttaaga
attagctaccttgtattacctgaagttcttctaaaggaatatcatgaacgcttcttttta
tacgagcaagctgttccaactctccatcagcggacgctcgggctgatgatgaaaaatgga
gagtggagtaagcatttaagaagagtgagaactgcttatcaactgaaacacagtactctt
ttagcagctttacagaaggagtttaacaaaaacatcacggtgtcaggagaatctgcaggt
ttgcatatacttatacgcatgcacaacgatatgaacgaacaggaattaattaacgcagct
cgaaagcaagatgtctccgtctacggtacctctcgttattggcttacggaagtacctaaa
caaaagcctcatgttttgttaggcttcggaagtttggggagagaagaaatagaagaagga
ataaaacgattaaaaaaagcttggttataa

DBGET integrated database retrieval system