KEGG   Bacillus megaterium DSM 319: BMD_0852Help
Entry
BMD_0852          CDS       T01219                                 

Gene name
citM
Definition
(GenBank) citrate transporter
  KO
K03300  citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CitMHS
Motif
Other DBs
NCBI-ProteinID: ADF37714
UniProt: D5DB63
Position
831523..832827
Genome map
AA seq 434 aa AA seqDB search
MLAILGFLMVCTFMFLIMTKRLTPLIALMVIPVLFAIIGGFTSDIGEMALNGVKELAPTG
VMLMFAILYFGIMIDAGLFDPVVGRILKIVKGDPLKITIGTAILVLIISLDGDGTTTYMI
TLSAMLPLYKKLNMKPMILACIAIMGSGVMNLTPWGGPTARVMSALKLDASQVFTPMIPA
MIGGAIWLLFTAYYFGKKERQRLGVIDIQDVTNAQVAFAEAAAAEGIEYKRPKLLWVNFA
LTALLLVGLITAVMPLQILFMIGFAIAIMINYPNLEVQKERITAHAGNVLAVVSLVFAAG
VFTGILSGTKMVDAMGNSLVGLIPDALGPYMSVITAITSMPFTFFMSNDAYYYGILPIIA
QAASAYGIDAAEIGRASLIGQPVHLLSPLVASTYLLVGMAKVELGEFQRFTLKWTIGTAM
MMLLVAIITGVITL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgttagctattcttgggtttttgatggtttgtacatttatgtttctaattatgacaaaa
cgattaacgccgcttattgctttaatggttattccagtattgtttgcaatcataggggga
ttcacaagtgatattggagaaatggctttaaatggtgtaaaagaattagcacctacaggc
gttatgttaatgtttgctattttatattttgggattatgattgatgctggtttgtttgat
ccagttgtaggaagaattttaaaaatcgtaaaaggtgatccactaaaaatcacaattggt
acagctattttagttcttattatctcattagacggagacggaacaacaacatatatgatt
acgctctcagcgatgcttccgctttataaaaagctaaacatgaagcctatgattttagcc
tgtatcgctattatgggtagtggagttatgaacttaacgccttggggcggccctactgct
cgcgtgatgagcgcattgaagttagatgcttcccaggtgttcacgccaatgattccagcc
atgattggtggagctatttggttattatttacggcttactatttcgggaaaaaagagcgc
cagcgcttaggtgtgattgatattcaagacgttacaaatgctcaagtagcttttgcagaa
gcagccgctgctgaaggaatcgagtacaagcgtccgaagcttttatgggtaaactttgct
ttaacagctctcttattagtaggacttatcacagcagtcatgccgcttcaaattctgttt
atgattggatttgcaatcgctatcatgattaactatccaaatttagaagttcaaaaagag
cgtatcacagcacatgctggtaatgtacttgctgttgtatctcttgtattcgcagcaggc
gtattcacaggcattttatcaggtacaaaaatggtagatgcaatgggtaacagtttagta
ggattaattccagatgcgttagggccttacatgtctgtgattacagctatcacaagtatg
ccatttacgttctttatgtcaaatgatgcttactactatggaattttaccaattattgct
caagcagcttcagcatacggtattgatgctgcagaaattggccgtgcttcattgattggt
caacctgttcacttactgagtcctttagttgcttctacgtatctattggtcggtatggca
aaagtcgagcttggtgaatttcagcgctttactttaaagtggacgattggaacagcgatg
atgatgcttttagtagctattattacaggagttattacgctgtaa

DBGET integrated database retrieval system