KEGG   Bacillus megaterium DSM 319: BMD_0867Help
Entry
BMD_0867          CDS       T01219                                 

Definition
(GenBank) haloacid dehalogenase-like hydrolase family protein
  KO
K07025  putative hydrolase of the HAD superfamily
Organism
bmd  Bacillus megaterium DSM 319
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Put_Phosphatase Retrotrans_gag
Motif
Other DBs
NCBI-ProteinID: ADF37729
UniProt: D5DB78
Position
849641..850300
Genome map
AA seq 219 aa AA seqDB search
MIKAVVFDFDGLIIDTESVWYEVYREMLEDRGVDLPIATFASYVGTDATALYDYLLQQFN
NEFTKEELAQESLRRHQEKMKSLVAREGVAEYLAEAKELGLKIGLASSSYRDWVTAFLKE
LDLLHYFEVIQTRDDVEKVKPDPALYRNAIEKLGVEPSEALAFEDSSNGAKAAMAAGLRC
VIVPNPLTKHLSFERYHLHIESMKEKTLKEVIQYLCIED
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagcagttgtgtttgattttgatggattaattattgatacagaatcagtgtgg
tatgaggtataccgcgaaatgttagaagacaggggagtagatctaccgattgcaacgttt
gcttcttatgtaggaacggatgctacggcactttacgattacttgcttcagcagtttaac
aatgagttcacaaaagaggaactagctcaagaatcgttaagacgtcatcaagaaaaaatg
aaatcattagtagcccgagaaggtgtagcggagtacttggcagaagcaaaagaacttgga
ttaaaaattggtttagcaagcagctcatatcgagactgggtaacagcatttttaaaagag
ctagatttgctgcactattttgaagtcattcaaacgcgcgatgatgtagaaaaagtgaag
ccagatccggctctttaccgaaatgcaattgaaaagctaggagtagagccctctgaagct
ttagcatttgaagattcttctaatggtgcgaaagctgctatggcagcaggcttgcgctgt
gtgattgtaccaaatccgttaactaaacatctgtcattcgagagatatcacttacacatt
gaatcgatgaaagagaaaactttaaaagaagtaattcagtatctttgtattgaagactaa

DBGET integrated database retrieval system