KEGG   Bacillus megaterium DSM 319: BMD_0884Help
Entry
BMD_0884          CDS       T01219                                 

Definition
(GenBank) acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
  KO
K20895  formylaminopyrimidine deformylase [EC:3.5.1.-]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00730  Thiamine metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BMD_0884
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     BMD_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADF37746
UniProt: D5DCC6
Position
867673..868950
Genome map
AA seq 425 aa AA seqDB search
MEETIDLLVKQVEERKGELVQLLKTLVSYKTPAPPARNSHEAQRYVADFLKNCGFSIDMW
DLYCNDPIVVGTLKGKKSAGYQSLIINGHMDVAEVQENEKWETNPFEAVVKDNMIIGRGV
ADMKGGLAGALFAVQLLTEAGIELPGDLIFESVVGEEVGEAGTLQCCQKGYTADFALVAD
TSDLHIQGQGGVITGWITIKSSKTYHDGTRRSMIHAGGGLLAASAIEKMAKVIGGLQELE
RHWAVTKSYPGFLPGTNTINPAVIEGGRHAAFIADECRLWITVHYYPNESYDQVSKEVEE
YILAIAKADPWLKDNLPTFEWGGTSMIEDRGEIFPSLEIDENHAGVQLLANTHEQIEGKK
PPIDVSTSVTDGGWLADAGISAAIYGPGNLANAHAVNEQLDMNQLIQYTKVMVQFIYTWL
HTHKE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaacaattgatttgcttgtcaaacaggtagaggagcgcaaaggggagctagtc
cagttattaaaaacgcttgtttcatataaaacgccggcgcctcctgcacggaattctcat
gaagcgcagcgctacgtagcggatttccttaaaaactgcggtttttccatcgatatgtgg
gatttatattgcaacgatcctattgtagtgggcacgttaaaagggaaaaaatcagctggc
tatcaaagcttaattattaacgggcatatggatgtagctgaggtacaagaaaatgaaaag
tgggagacaaatccgtttgaagctgtggtaaaagacaacatgataatcggacgcggagtt
gctgatatgaaaggcggcttggcaggagcattatttgcagttcagcttctaacagaagca
ggaatcgaactgccgggagacttgatttttgaatccgttgtaggagaagaagtgggagag
gcaggtacgctgcaatgctgtcagaaaggatatacagctgactttgcgcttgttgccgat
acgagtgatttacatattcaaggtcaaggcggagtgatcacgggatggattacgataaaa
agcagtaaaacctatcatgacggtacacgccgaagtatgattcatgctggaggagggctg
ttagctgcgagtgctattgaaaagatggcaaaagtgatcggagggctgcaagaattggag
cgccactgggctgttacaaaaagctatccaggatttttgccgggaacaaatacgattaat
ccagcagtaatcgaagggggaaggcatgctgcgtttattgcagatgaatgcaggctgtgg
atcaccgttcactattatcccaatgaatcatacgaccaagtatcaaaagaagtggaagaa
tacattttagctattgcaaaagcagatccatggttaaaagataacctgccaacctttgaa
tggggaggcacatcaatgattgaagacagaggagaaattttcccgtcattagaaattgat
gaaaatcatgctggagtacagctgcttgcaaatactcatgaacaaattgaagggaaaaag
cctccaatcgatgtgtcaactagcgtaacagatggcggttggctagctgatgcggggatt
tctgcggctatttacggtccggggaatttagcaaatgcacatgctgtgaatgaacaatta
gatatgaatcagcttattcaatatacaaaagtgatggtgcagttcatttatacgtggctg
catacgcataaggagtga

DBGET integrated database retrieval system