KEGG   Bacillus megaterium DSM 319: BMD_1126Help
Entry
BMD_1126          CDS       T01219                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMD_1126 (galU)
   00052 Galactose metabolism
    BMD_1126 (galU)
   00500 Starch and sucrose metabolism
    BMD_1126 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BMD_1126 (galU)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMD_1126 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1113382..1114263
Genome map
AA seq 293 aa AA seqDB search
MQKVKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKG
KRAIEDHFDNAPELEQNLAEKGKFEVLEKVRQSSNVEIHYIRQKEPKGLGHAVWCARNFI
GNEPFAVLLGDDIVQAETPGLRQLMDEYEQTLSSVIGVQTVGDNETHRYGIVDPNSSKGR
RYQVNSFVEKPAPGTAPSNLAIMGRYVFTPEIFKFLEEQEVGAGGEIQLTDAIQKLNEIQ
RVFAYDFEGKRYDVGEKLGFIQTSLEFALQHEDLREDLLVFMEELLKLEKVRV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagttaaaaaagccattattccagcagcaggattaggtactcgttttttacca
gcaacaaaggctatgccaaaggaaatgcttcccattgtagataaaccaacgattcaatac
attattgaagaggcaattgaatcaggaattgaagacatcattatcgtaacaggtaaaggt
aaacgtgccattgaagatcactttgataatgcacctgaactagagcagaatttagctgaa
aaaggaaagtttgaagtattagaaaaagttcgtcagtcttcaaatgttgaaattcactat
attcgtcaaaaagagccgaaaggattaggacatgcggtatggtgcgctcgtaattttatt
ggtaatgagccttttgcggtattactaggggatgacatcgttcaagcagaaactccaggc
ctgcgccaattaatggatgaatatgaacaaacattatcatcagtaattggcgttcaaaca
gttggtgataatgaaacacaccgttatggcattgtagatccaaattcaagcaaaggccgc
cgttatcaagttaattcgtttgttgaaaagccagcaccaggaactgctccttctaatcta
gctattatgggacgatatgtgttcacaccggaaatttttaaattcttagaagagcaagaa
gtaggggcaggcggagaaatccagttaacggatgcaattcaaaaattaaatgaaattcag
cgcgtatttgcttacgattttgaaggcaaacgttatgatgtaggtgaaaagttaggcttt
atccaaacatctttagaatttgcgcttcagcatgaagatttacgtgaagatcttctagta
tttatggaagaattgctaaaactagaaaaagtacgcgtgtaa

DBGET integrated database retrieval system