KEGG   Bacillus megaterium DSM 319: BMD_1205Help
Entry
BMD_1205          CDS       T01219                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMD_1205
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BMD_1205
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMD_1205
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BMD_1205
Exosome [BR:bmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMD_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1193830..1195485
Genome map
AA seq 551 aa AA seqDB search
MRKKLAGITLAGAVALASFGVGNSLIQTEAKVERKSAKKPQNVIMMVMDGTSSNATTLAR
WYKGKPLHMDQLMAGGVRAYSAESAITDSAPAATALATGNKSNSGYVGVLPSVVNTPGIK
PIEKEDQFRPVANVLEGAKLSGRATGIVATSEIQHATPAGFSAHNYSRDDFQTLAEQQVY
QNIDVVLGGGKQSLLPGKEEKSRKDGENLVNVLNKRGYDFVENKKELEQSRAKKIWGSFA
DRDLAYDMDRPQTKAEQPKLSQMTNKAITTLSKDKDGFFLFVEGSKTDWAAHANDPVGMI
SDVLAFDEAVGKAVEFAEKDGNTMVIAIADHGNSGLSIGNANTTKGYDTTPVSAYIDPLK
KAKMTLEGATSKLKEDLSNKEEVAALYGLSNLTSEEKAQLTKARDKKEISAALSKLLANR
ANLGFTTGGHTGEDVFLYSYGVNRPTGHFDNTDIAKHMAKSMNINLNQLTNELFIEANKA
FKGSKVAVDSKDKNNPVLVVTNNKRTVRFPVNKNIAIVNGREIQMDSVVVQDKKNRFFVS
KQAQQIVKNEK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaattagcaggtattacactggcaggagctgtagcattggcctcgtttggt
gtaggaaactcccttattcaaacggaagcaaaagtggagcgtaagtcagctaagaaacct
caaaatgtcattatgatggtaatggacgggacgagttcaaatgctactacactcgcaaga
tggtacaagggaaaaccgttacatatggatcagctgatggccgggggagtacgtgcgtat
tcggcagaatctgctattacagattctgctccggcagctactgctttagcgacaggaaat
aaatcgaattcaggttatgtaggtgtgctgccttcggtagtgaatacacctggaattaaa
cccatagaaaaagaagatcaatttcgtcccgtagcaaacgttctagaaggagcaaagctt
tcagggcgcgcgacgggaattgtggctacttctgaaatccagcatgctacaccagctggt
ttttcagctcacaactacagccgtgatgattttcaaacgctagcggagcagcaagtgtat
caaaacattgatgtagtacttggaggaggtaagcaatctcttctaccaggaaaagaagaa
aaaagccgaaaagacggtgaaaatttagtcaatgtattgaacaaaagaggatatgacttt
gtagaaaataaaaaagaattagagcagtcacgcgccaaaaaaatctgggggagctttgcc
gaccgagatttagcgtatgatatggacaggccgcagacaaaagcagaacagccaaagttg
tcccagatgacaaataaagcaataacaacactatccaaagataaagacggttttttctta
tttgttgaaggaagcaaaacggattgggcagctcatgcgaacgatccagtaggaatgatt
agcgatgtactagcgtttgatgaagcagtaggcaaagcagtagaattcgctgaaaaagat
ggaaatacgatggttattgcgattgccgatcacggaaacagcggtctttcaatcggtaat
gcaaatacaacaaaaggatatgataccacacctgtttctgcttatattgatccattaaaa
aaagcaaaaatgacgttagaaggtgctacgtctaaattaaaagaagatttatcaaataaa
gaagaagtagctgctctgtatggtttatcaaatctaacttcagaggaaaaagcgcagctg
actaaagcaagagataaaaaagaaatcagtgctgcactatcgaagttattagccaaccga
gcaaaccttggattcacaacgggcggtcatacgggtgaggatgtatttctgtattcatac
ggcgtaaatcgaccaacggggcactttgataatacggatattgccaaacatatggctaaa
tcaatgaatattaacttaaaccagttaacaaatgaattatttattgaagcaaataaagct
tttaaaggctcaaaggtagcggttgactcaaaagacaaaaacaaccctgtgctggttgtt
acaaacaataagcgaacggtgcgttttccagtaaataaaaatattgctattgtaaatgga
agagaaattcaaatggacagcgtagtggtacaggataaaaagaatcgcttctttgtatca
aaacaagcacagcaaattgtaaaaaatgaaaaataa

DBGET integrated database retrieval system