KEGG   Bacillus megaterium DSM 319: BMD_1237Help
Entry
BMD_1237          CDS       T01219                                 

Gene name
mtnD
Definition
(GenBank) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00270  Cysteine and methionine metabolism
bmd01100  Metabolic pathways
Module
bmd_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BMD_1237 (mtnD)
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BMD_1237 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BMD_1237 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding Cupin_3
Motif
Other DBs
NCBI-ProteinID: ADF38098
UniProt: D5DCZ9
Position
1228727..1229242
Genome map
AA seq 171 aa AA seqDB search
MAHIRLHVNNKRIETQEEVSAFLANNEVIYENWDITKLPENLREKYDLTDEEKTEILNAF
GEDIKDISERRGYKAQDVISLSESTPNIDELLKNFQRKHIHTDDEVRFIVSGHGIFVIQG
KDGEFFDVELEPGDLISVPENILHYFTLMEDRKVVAVRIFVTTEGWVPIYA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacattcgcttacatgtaaacaataaaagaattgaaactcaagaggaagtatca
gcttttctggcaaacaatgaagttatttatgaaaactgggacattacaaaacttccagaa
aatcttcgtgaaaaatatgatttaactgatgaagaaaaaacagaaattttaaacgctttt
ggtgaggacattaaagacatttctgaacgccgcggctataaagctcaagatgttatctcg
ttatcggaatctacaccaaatattgatgaattgttaaaaaactttcagcgcaagcatatt
cacacagatgacgaagttcgctttattgtaagcggtcatggaatctttgttattcaagga
aaagacggcgaattttttgatgttgaattagagccgggcgatttaatttcagtaccagaa
aacattcttcattactttacattaatggaagatcgcaaagtagtcgctgtccgaattttc
gtgacaactgaaggatgggtacctatttacgcataa

DBGET integrated database retrieval system