KEGG   Bacillus megaterium DSM 319: BMD_1850Help
Entry
BMD_1850          CDS       T01219                                 

Gene name
mro
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmd00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmd00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1848407..1849462
Genome map
AA seq 351 aa AA seqDB search
MKVNFEKFGELNNQAVHAYTLLNDEGLKITCLDYGCVISNIEMPDSEGKIESVVLGFDSI
EEYQKYSPYFGAVVGRVAGRIGGAAFELNNEIYRLEKNEGNNHLHGGSEGFSHKIWNAKT
IDASDHVGVEFTYVSKDGEEGYPGNLEVKVTYTLTNKNEFHISYEGTTDQDTLINLTNHT
YFNLSGNLKETVLDHVLKLKSNEFLELNDDLLPTGEVLNVTDTPFDFREGHSLKEGVEST
HPQNVLVGKGYDHPFLLEAEAENQMSLFDPASGRKIEVKTDQPSVVLYTGNHLDEEFEIR
GVHSQKYLGVCLETQGLPDAIHHKHFPSCVLKPGEKYKAYTHYTFITDRSL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaattttgagaaatttggcgaactaaacaatcaagctgtacatgcttatacc
ttattaaatgatgaaggccttaaaatcacctgccttgactatggatgtgtgatatcaaat
attgaaatgccggattctgaagggaagattgaaagtgttgtattgggatttgattcaata
gaagaataccaaaagtattctccttatttcggagctgtggtcggacgcgtagcagggcgt
ataggcggagcagcgtttgaacttaataatgaaatctatcgtctagagaaaaatgaagga
aacaaccatttgcatggcggatcagaaggatttagtcacaaaatatggaatgccaaaaca
attgatgcaagtgatcatgtaggcgttgaatttacatatgtaagtaaagacggagaagaa
ggctatcccggcaacctcgaagtgaaagtgacgtatacattaacgaataaaaatgagttc
catatttcttacgaaggaacaacagatcaagatacacttatcaatttaacaaatcatacg
tatttcaatttaagcggaaatctaaaagaaacggtgttggatcatgttttgaagctgaaa
agtaacgaattcttagagttgaatgatgatcttttacctactggagaagtgttaaacgtc
acagataccccatttgattttagagaaggacatagtctcaaggaaggagtggaatccaca
catccgcaaaatgtattagtgggtaaaggatacgatcatccatttcttttagaagcagaa
gctgaaaatcagatgtcattatttgatcctgcaagcggccgcaaaatagaagtcaaaacg
gatcagccttcagtcgttctctatacgggaaatcatctagacgaagagttcgaaattaga
ggggttcactcacagaaataccttggcgtttgcttagaaacacaaggtttgccagacgct
attcatcataagcattttccttcttgtgtattaaagcccggtgagaagtataaagcatat
actcactatacatttataactgatcgcagcctgtaa

DBGET integrated database retrieval system